KEGG   Sinorhizobium meliloti AK83: Sinme_6704Help
Entry
Sinme_6704        CDS       T01521                                 

Definition
Succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
smk  Sinorhizobium meliloti AK83
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:smk01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:smk00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSINME01:complement(88058..89212)
Genome map
AA seq 384 aa AA seqDB search
METTIARPADSSLISFDPIQFLQQVVSIDSCDPPGGELEVAKLVHEQLLSLGIEAALDEF
LPGRANVLGRIRGSGEKPAFVLSSHMDTVPVGTVSWKRPPFSGVIEGGRLYGRGATDMKS
ALASMIAAAGSLARKAHLLKGDVILAFTAGESANLLGARRFVEQGLKNEIGAFLCGEPSD
LDVIIVEKAALWLRATATGRLGHVSGAAGINAIDVVREFLGSLKTMELNCPPHPLLDEPT
IRVGRIEGGSAVNLTPDNCTVDFDIRLPPGVDHLSIVRQVENIVPENMTISILDFKPAVE
SLPDDEFVKLCTDVCARHRGKAPAIKGASYYSDGTVLLEGLSVPFAIIGPGELGLSGQAD
ESVSTDNLLKAVEIYEDVALAWLS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgacaatcgctagaccggctgactccagcttaatttcctttgatccaatccag
tttctacaacaggtggtctcaatcgacagctgcgatccgccgggtggtgagcttgaagtc
gccaagcttgttcacgaacagcttctatcacttggcatcgaggccgcgctggacgagttc
ctccccgggcgggcaaatgtcttaggacgaatacgcgggtccggggaaaagccggccttc
gtgctctcttcgcatatggatacggttcctgtcggcactgtgtcctggaagcgacctcct
ttctccggagtgattgaaggcggccggttatacggtcgtggagcaactgacatgaagagc
gcgctggcctccatgatcgcagcagccgggtctttggcgagaaaagcgcatctgttgaag
ggcgacgtcatactggcgtttacggccggtgagagcgccaacctgctcggcgcgcggcgc
tttgttgagcaaggtttgaaaaatgaaataggtgctttcctttgcggtgagccaagcgat
ctcgacgtcatcattgttgagaaagctgccctgtggcttcgagctacggcgaccggcagg
ctcggacacgtatctggcgcggctggcatcaacgctatcgacgttgtccgagagtttctc
ggcagcttgaagacaatggagctcaattgcccgcctcatccgcttctcgatgagccgacc
atccgagtggggcgaatcgaaggcggttctgccgttaacctgacccccgataactgcaca
gtcgacttcgatatccgccttccaccaggtgtcgatcatctctcgatcgtcagacaggtt
gagaacatcgttcctgagaatatgacgatcagcatcctcgacttcaaacccgctgtcgaa
agtcttccggatgatgaattcgtcaagctttgcaccgatgtttgcgcccgccatcgaggc
aaagcgccggcgatcaagggcgcgtcctattatagtgacggaacggtgttgctcgaaggt
ctatcggtgccgtttgcgatcattgggcctggcgaacttggacttagtggtcaggcggac
gaatccgtttccacagacaacctactcaaggctgtcgagatatacgaagacgtcgccttg
gcatggctctcgtga

DBGET integrated database retrieval system