KEGG   Stenotrophomonas maltophilia K279a: Smlt0090bHelp
Entry
Smlt0090b         CDS       T00718                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sml03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87969..88781
Genome map
AA seq 270 aa AA seqDB search
MPELPEVETTRRGLAPHLQGRRVHGVILRRADLRWPIPPEVAELLPGQRIEDIRRRAKYL
LLDTAIGSAVLHLGMSGSLRVLPGDTPLRAHDHVDISLDNGRLLRFNDPRRFGSLLWQPA
GEVHPLLQGLGPEPLDDAFDGDYLFARSRGRSAPVKTFLMDQAVVVGVGNIYAAESLFKA
GISPLREAGKISRERYQRLADAVKEILGYAITRGGTTLRDFISPDGAPGYFEQELLVYGR
DGLPCPNCGRALKHATIGQRASVWCSHCQR
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgcccgaagtcgaaaccacccgccgcggcctggcgccgcacctacagggc
cgccgcgtgcatggcgtgatcctgcgccgcgccgacctgcgctggccgattccgccggaa
gtggccgagctgctgccggggcagcgcatcgaggacatccgccgtcgcgccaagtacttg
ctgctggacaccgccatcggcagcgccgtgctgcacctgggcatgtccggcagcctgcgt
gtgctgcccggcgataccccgctgcgcgcgcacgaccatgtggatatcagcctggacaac
ggccgcctgttgcgcttcaacgacccgcgccgcttcggcagcctgctgtggcagccggcc
ggcgaagtccacccgctgctgcaggggctgggcccggagccgctggacgatgccttcgac
ggggactacctgttcgcccgcagccgtggccgcagcgcgccggtgaagaccttcctgatg
gaccaggcggtggtggtgggcgtgggcaacatctacgccgccgagagcctgttcaaggcc
ggcatcagtccgctgcgcgaggccgggaaaatctcgcgcgagcgctaccagcggctggcc
gatgcggtgaaggagatcctcggctacgccatcacccgtggtggcaccaccctgcgtgac
ttcatcagccccgatggcgcgccgggctacttcgagcaggaactgctggtgtacggccgt
gacgggctgccctgcccgaactgtggccgcgcgttgaagcacgccaccatcggccagcgc
gccagcgtctggtgcagccactgccagcgctga

DBGET integrated database retrieval system