KEGG   Stenotrophomonas maltophilia K279a: Smlt0164Help
Entry
Smlt0164          CDS       T00718                                 

Gene name
fadI
Definition
(GenBank) putative 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smlt0164 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    Smlt0164 (fadI)
   00640 Propanoate metabolism
    Smlt0164 (fadI)
   00650 Butanoate metabolism
    Smlt0164 (fadI)
  Lipid metabolism
   00071 Fatty acid degradation
    Smlt0164 (fadI)
   00072 Synthesis and degradation of ketone bodies
    Smlt0164 (fadI)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smlt0164 (fadI)
   00310 Lysine degradation
    Smlt0164 (fadI)
   00380 Tryptophan metabolism
    Smlt0164 (fadI)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Smlt0164 (fadI)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Smlt0164 (fadI)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Smlt0164 (fadI)
Enzymes [BR:sml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Smlt0164 (fadI)
Exosome [BR:sml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smlt0164 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
177952..179247
Genome map
AA seq 431 aa AA seqDB search
MPGISMPNARPVAILGGVRIPFCRQNTAYSDVGNLGMSVRTLGALVERFGLHGQQLGEVA
MGAVIKHSSDWNLGREATLSSGLSPLTPGITLQRACGTSLDSIITVANKIALGQIESGIG
GGSDTTSDVPIVYGKKLRARLLAANRAKSTGDKIRALTSGFKFSELKPEFPGVAEPRTGK
SMGDHCEDMAKEWNISRDSQDEWAVSSHKKLAAAYERGFFNDLIAPFRGVERDNILRPDT
SLEKLATLKPAFDKVSGRGTLTAANSTPLTDGAAAVLLASEEWARAHGHEPQAYLRDAHV
SAVDFVHGEGLLMAPTVAVPEMLKRNGLTLQDFDIYEIHEAFAAQVLCTLRAWESEDYCR
NRLGLDAPMGRIDPDKINLLGSSLATGHPFAATGARVIATAAKQLAERGGGRALVSICTA
GGMGVVAIVER
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtatctccatgcccaacgctcgtcccgtcgccatcctcggtggcgtccgcatt
ccgttctgccgccagaacaccgcgtattcggatgtcggcaacctcggcatgtcggtccgt
acgctgggcgcgctggtcgaacggttcggcctgcacggccagcagctgggtgaagtggcg
atgggtgcggtgatcaagcactccagcgactggaacctgggccgtgaagccacgctgtcg
tccggcctgtcgccgctgaccccgggcatcacactgcagcgcgcctgtggcacctcgctg
gacagcatcatcaccgtcgccaacaagatcgcgctgggccagatcgaatcgggcatcggc
ggcggttcggacaccacctccgacgtgccgatcgtctacggcaagaagctgcgcgcgcgc
ctgctggccgccaaccgtgccaagagcactggcgacaagatccgcgcgctcacttccggc
ttcaagttctccgagctcaagcccgagttcccgggcgtggccgagccgcgcaccggcaag
agcatgggcgaccactgcgaggacatggccaaggaatggaacatctcgcgcgactcgcag
gacgagtgggcggtgtcctcgcacaagaagctggccgctgcctatgagcgcggtttcttc
aacgatctgatcgcaccgttccgtggcgtcgagcgcgacaacatcctgcgtccggatacc
tcgctggaaaagctggccacgctgaagccggccttcgacaaggtctccggccgtggcacc
ctgaccgccgccaactccacgccgttgaccgatggcgccgccgcggtgctgctggccagt
gaagagtgggcgcgtgcgcacggccatgagccgcaggcgtacctgcgcgatgcgcacgtc
tctgcggtggacttcgtgcatggcgaaggcctgctgatggcaccgaccgtggccgtgccg
gagatgctcaagcgcaatggcctgaccctgcaggacttcgacatctacgagatccacgag
gccttcgctgcacaggtgctgtgcaccctgcgtgcgtgggagagcgaggattactgccgc
aaccgcctgggcctggatgcaccgatgggccgtatcgacccggacaagatcaacctgctg
ggctcgtcgctggccaccggccatccgttcgccgccaccggtgcacgtgtgattgctacc
gcagccaagcagctggccgaacgcggcggtggccgcgcgctggtgtcgatctgcaccgcc
ggcggcatgggcgtggtggcgatcgtcgaacgctga

DBGET integrated database retrieval system