KEGG   Stenotrophomonas maltophilia K279a: Smlt0231Help
Entry
Smlt0231          CDS       T00718                                 

Gene name
mls
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smlt0231 (mls)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Smlt0231 (mls)
   00630 Glyoxylate and dicarboxylate metabolism
    Smlt0231 (mls)
Enzymes [BR:sml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Smlt0231 (mls)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
243005..244627
Genome map
AA seq 540 aa AA seqDB search
MSAVASAVPTPASKATPGIALATRVAGQDTVLPAPLLALLVSLHRAVEPGRQARLQARRE
RQAFFDQGGLPDFREDTTAIRSGDWRVAPLPAALQDRRVEITGPTDPKMVINALNSGAKV
FMADFEDSTSPTWRNLLAGQQSLAAAVRGDLEFTAANGKHYTLRPYDEQAVLIVRPRGWH
LDEKHVRIDGQFIAGGLFDAAVFAFHNARTLQAKDRGPYFYLPKLQSMEEAALWETALSH
IEGMLGLPHGQIKVTVLIETLPAVFEMDEILHALRDRIVGLNCGRWDYIFSYLKTFRRHA
DRVLPERGQVTMTQPFLKAYSELLIQTCHRRGAHAMGGMAAQIPINNDAAANEQAMARVR
ADKLREVTAGHDGTWVAHPALIPVAMAIFDEHMPGANQHSVLRQDVRVGRDELIARPPGT
ITRAGFEGNVEVCVRYLAAWLDGNGCVPIHHLMEDAATAEISRSQLWQWLHTPGQQLDDG
TAIDLALLDSTLSQLPARLGDTAALPGGTRIGEAITLLGELSRSDELTDFLTLPAYARID
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgtcgcttccgctgttcccacccctgccagcaaggccacccccggcatcgcc
ctggcgacccgcgtggccggtcaggacaccgtgctgccggcgccgctgctggccctgctg
gtgtcgctgcaccgtgcggtggaaccgggccggcaggcacggctgcaggcccgccgtgaa
cgccaggcgttcttcgaccagggcggcctgccggacttccgtgaagacaccaccgcgatc
cgtagcggcgactggcgcgttgcgccgctgccggccgcgctgcaggatcgccgcgtcgag
atcaccggcccgaccgacccgaagatggtcatcaacgcgctgaactccggcgccaaggtg
ttcatggccgactttgaggattcgacctcgccgacctggcgcaacctgctggccgggcag
cagtcgctggcggcggcggtgcgtggtgatctggaattcaccgccgccaatggcaagcac
tacacgctgcgcccgtacgacgaacaggccgtgctgatcgtgcgcccgcgcggctggcat
ctggacgagaagcacgtgcgcatcgacggccagttcatcgccggcggcctgttcgacgcg
gcggtgttcgccttccacaacgcccgcaccctgcaggccaaggaccgcggcccgtacttc
tacctgcccaagctgcagagcatggaagaggccgcgctgtgggagaccgcgctgtcgcac
atcgaaggcatgctcggcctgccgcacggccagatcaaggtgaccgtgctgatcgaaacg
ctgccggcggtgtttgagatggacgagatcctgcacgcactgcgtgaccgcatcgtcggc
ctgaattgcgggcgctgggattacatcttctcgtacctgaagaccttccgccgccacgcc
gaccgcgtgctgcccgaacgcggccaggtgaccatgacccagccgttcctgaaggcgtat
tcggaactgctgatccagacctgccaccgccgcggtgcgcatgcgatgggcggcatggcc
gcgcagatcccgatcaacaacgatgccgcggccaacgaacaggcgatggcccgggtgcgc
gccgacaagctgcgcgaagtcaccgccggccatgacggcacctgggttgcgcatccggcg
ctgattccagtggcgatggcgatcttcgacgaacacatgcccggtgcgaaccagcacagc
gtgctgcgccaggatgtgcgcgtgggccgcgatgaactgatcgcgcgcccgccgggcacc
atcacccgtgccggcttcgaaggcaacgtggaagtctgcgtgcgctacctggcggcgtgg
ctggatggcaacggttgcgtgccgatccaccacctgatggaggacgcggccaccgccgag
atcagccgcagccagctgtggcagtggctgcatacgccgggccagcaactggacgacggc
actgcgatcgatctggcgctgctggattccactctctcgcagctgccggcacggctgggc
gataccgccgcgctgcctggtggtacacgcatcggcgaagccatcaccctgctcggcgaa
ctgagccgcagcgacgaactgaccgatttcctgaccctgccggcctacgcgcgcatcgat
tga

DBGET integrated database retrieval system