KEGG   Stenotrophomonas maltophilia K279a: Smlt0232Help
Entry
Smlt0232          CDS       T00718                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smlt0232 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Smlt0232 (aceA)
Enzymes [BR:sml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Smlt0232 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
244693..245994
Genome map
AA seq 433 aa AA seqDB search
MSKLPTAEQIQHDWDTNPRWEGIQRNYSAADVVRLRGTVHIEHSLARLGAEKLWASLHER
EFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGQMYPDQSLYPADSVPAVVKR
INNTLLRADQLHHAEGKDDIDFLQPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFEDQ
LASVKKCGHMGGKVLVPTREAIEKLNAARLAADVLGVPTLLVARTDAEAADLLTSDIDGN
DRPFTTGERTVEGFYKTRNGLDQAISRGLAYAPYADLVWCETGKPDLEFARRFAEAIHAK
FPGKLLAYNCSPSFNWKKNLDDATIAKFQRELGSYGYKFQFITLAGFHALNYGMFNLAHG
YARRQMSAFVELQEAEFEAAERGFTAVKHQREVGTGYFDAVTQAIQQGQSSTTALTGSTE
EEQFHGGRSERAA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcccactgccgaacagatccagcacgactgggataccaacccgcgctgg
gaaggcatccagcgcaactacagcgccgccgacgtggtgcgcctgcgcggcaccgtccac
atcgagcactcgctggcccgcctgggtgcggagaagctgtgggcgtcgctgcatgagcgc
gagttcgtcaacgcgctgggtgcgctgaccggcaaccaggccatgcagcaggtcaaggct
ggcctgaaggccatctacctgtccggttggcaggtggcggccgacgccaacctggccggc
cagatgtacccggaccagtcgctgtacccggccgattcggtgccggcggtggtcaagcgc
atcaacaacacgctgctgcgtgccgatcagctgcaccacgccgaaggcaaggatgacatc
gacttcctgcagccgatcgtggctgacgccgaagccggtttcggcggcgtactcaacgcc
ttcgaactgatgaaggcgatgatcgaggccggcgccgccggcgtgcatttcgaagaccag
ctggcgtcggtgaagaagtgcggccacatgggcggcaaggtgctggtgccgacccgtgag
gccatcgagaagctcaacgccgcacgcctggccgccgacgtgctgggcgtgccgaccctg
ctggtcgcgcgcaccgatgccgaggccgcggatctgctgaccagtgacatcgacggcaac
gaccgcccgttcaccactggcgagcgcaccgtcgagggcttctacaagacccgcaatggc
ctggaccaggcgatcagccgtggcctggcctacgcgccctacgccgacctggtgtggtgc
gagaccggcaagccggacctggaattcgcacgcaggttcgccgaggcgatccatgcgaag
ttcccgggcaagctgctggcctacaactgctcgcccagcttcaactggaagaagaacctg
gacgacgccaccatcgccaagttccagcgtgagctgggcagctatggctacaagttccag
ttcatcaccctggccggcttccacgcgctgaactacggcatgttcaatctggcccacggc
tacgcacgccgccagatgagcgcgttcgtggaactgcaggaagccgagttcgaagccgcc
gagcgcggcttcaccgcggtcaagcaccagcgcgaggttggcaccggctacttcgatgcc
gtgacccaggcgatccagcagggccagtcctcgaccaccgcgttgaccggctcgaccgaa
gaagagcagttccacggcgggcgcagcgaacgcgccgcgtga

DBGET integrated database retrieval system