KEGG   Stenotrophomonas maltophilia K279a: Smlt0341Help
Entry
Smlt0341          CDS       T00718                                 

Gene name
argI
Definition
(GenBank) putative arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00220  Arginine biosynthesis
sml00330  Arginine and proline metabolism
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01130  Biosynthesis of antibiotics
sml01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Smlt0341 (argI)
   00330 Arginine and proline metabolism
    Smlt0341 (argI)
Enzymes [BR:sml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Smlt0341 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: CAQ43942
UniProt: B2FJ13
Position
341542..342462
Genome map
AA seq 306 aa AA seqDB search
MAHPISVSLIGVPTDVGAGHRGARLGPEALRVAGLPEALEARGVDVRDLGNLDGPRNPWT
APVEGYRHLDEVVAWNHALMEASYAELQAGRMPIMLGGDHCLGIGSITAVARWCREQGKT
LRVLWLDAHSDFNTSDVTPSGNIHGMPVACLCGLGPKALTHLGGSAPAITPIQVHQIGIR
SVDPEEKRLIKTHKVDVYDMRYIDENGMKRAVEAALAGIDENTHLHVSFDVDFLDPSIAP
GVGTTVPGGVNYREAQLVMEMIADTGRMGSLDIVELNPLLDKQNATAELAVDLVESLFGK
STLMRD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcccatcccatttccgtatccctcatcggcgtgcccaccgacgtgggcgcgggccat
cgtggtgcacggcttggtccggaagccctgcgcgtggccggcctgcccgaggcgctggaa
gcgcgcggcgtggacgtgcgcgacctgggaaacctggatggcccgcgcaacccgtggacc
gcgccggtggaaggctaccgccacctggatgaagtggtggcgtggaaccacgcactgatg
gaagccagctatgccgagctgcaggccggtcgcatgccgatcatgctcggcggcgaccac
tgcctgggcatcggttcgatcactgccgtggcacgctggtgccgcgagcagggcaagacc
ctgcgcgtgctgtggctggatgcgcattcggacttcaacaccagcgatgtcactccatcg
ggcaacatccacggcatgccggtggcctgcctgtgcggcctcggcccgaaggcgctgacc
cacctcggcggcagcgcaccggcgatcacccccatccaggtgcaccagatcggcatccgt
tcggtggacccggaagagaagcgcctgatcaagacccacaaggtggatgtctacgacatg
cgctacatcgacgagaacggcatgaagcgcgcggtcgaggcagcactggcgggcatcgac
gagaacacccacctgcatgtcagcttcgatgtggatttcctcgacccgagcatcgcaccg
ggcgttggcaccaccgtgccgggcggggtgaactaccgcgaggcgcagctggtgatggag
atgattgccgacaccgggcgcatgggttcgctggacatcgtcgagctcaaccccttgctg
gacaagcagaatgccaccgccgaactggccgtggacctggtcgaaagcctgttcggcaag
tccaccctgatgcgcgactga

DBGET integrated database retrieval system