KEGG   Stenotrophomonas maltophilia K279a: Smlt0403Help
Entry
Smlt0403          CDS       T00718                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smlt0403 (algC)
   00030 Pentose phosphate pathway
    Smlt0403 (algC)
   00051 Fructose and mannose metabolism
    Smlt0403 (algC)
   00052 Galactose metabolism
    Smlt0403 (algC)
   00500 Starch and sucrose metabolism
    Smlt0403 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    Smlt0403 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    Smlt0403 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smlt0403 (algC)
Enzymes [BR:sml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Smlt0403 (algC)
    5.4.2.8  phosphomannomutase
     Smlt0403 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
397272..399614
Genome map
AA seq 780 aa AA seqDB search
MSGIGEGQRERSLGRSAPLLGVLLVLLAGWFGWSAVQQWRQEANGQALEEARDQAVQGLQ
EAAAGQLKQLQQQLKNERVQQALQAGDAAAAALAVRESWTGVEQADVLTADLATAYADPA
TFGYARLALLEQALAEGKPGLRVVRDAGGNRLGLAAPVQLGSLGPAVLYVRQPLLRLTSP
LDQVSAPSTGFLGLRQGTHDLVAQGDAGLAESAEALARPVPGTPLRLVAAVPNVEAGPLG
LGSLASAIVALLLAFIAVLLVVGRGRLPKSLPLPRRAAVAEADHGPTLSESLQMAPPPVA
AASAADTAPPPPPVPAGELAAGIFRAYDIRGVVGSELTPKTAALIGQAIGTVALEQGLRE
VVIGRDGRLSGPELAAGLAEGLRRTGCAVIDIGLAPTPVVYYAAFHLRTGTCVAVTGSHN
PPEYNGFKVVIGGETLSGDAITDLYQRIVEGRLAQAAEPGDYQQRDVSADYIQRIADDVQ
LDRPLKVVADAGNGVAGALAPQLLEAIGAEVIPLYCDVDGTFPNHHPDPSEPANLEDLVQ
TVKRFGADLGVAFDGDGDRLGVVTGEGRIIYADRLLMLFAADVLMRNPGAMVIYDVKCTG
KLSDHVLRNGGSPLMWKTGHSLMKAKMRETDAELAGEMSGHFFFKERWFGFDDGLYAAAR
LLEILAQREETPDEVLAELPEMVATPELKVPVAEGTPHALVAMLVAAAQSPDNPYVGGRL
STIDGLRVDFPDGWGLVRASNTTPVLVLRFEGNDEAALERIQALFRSQLQPVLGDTPLGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcatcggggaagggcagcgggaacggtcgttgggacgcagtgcgccactactg
ggggtgctgctggtcctgctggccggctggttcggatggagcgcggtgcagcaatggcgg
caggaggccaacggccaggcgctggaagaagcgcgtgaccaggccgtgcagggcttgcag
gaggccgcagccggccagctgaagcagctgcagcagcagttgaagaacgaacgcgtgcag
caggcactgcaggccggtgacgccgcggcagcggcgctggccgtgcgcgagagctggacc
ggcgtggagcaggctgacgtgctgaccgccgatctggccacggcctatgccgacccggcc
accttcggctacgcacgcctggccctgctggaacaagcgctggccgagggcaagcctggc
ctgcgcgtggtgcgcgatgcaggtggcaatcgcctgggtctggcggctccggtgcagctg
ggcagccttggcccggcagtgctctacgtgcgccagccattgctgcggctgacctcgccg
ctggaccaggtgagcgccccgtccaccggcttcctcggcctgcgccaaggcacgcatgac
ctcgttgcccagggcgacgccggcctggccgagagcgccgaagcgctggcgcgcccggtt
ccgggcacgccgttgcggctggtggccgccgtaccgaatgtcgaagccggtccactgggc
ctgggttcgctggccagtgccatcgtcgcgctgctgctggcgttcatcgccgtgctgctg
gtggtgggtcgcggtcggctgccgaagtcgctgccgttgccgcgccgtgcggccgtggcg
gaagcggatcatggcccgaccctgagcgagagcctgcagatggcgccgccaccggtggcc
gccgccagcgccgcggacactgcgccgccgccgccaccggtccctgccggggaactggcc
gccggcatcttccgcgcctacgacatccgtggcgtggtcggcagcgaactgacgccgaag
accgccgcgctgatcggccaggccatcggtaccgtggcgctggaacagggcctgcgcgag
gtggtgatcggccgtgatggccgcctgtccggcccggaactggctgcgggattggccgaa
ggcctgcgtcgcaccggttgcgcggtgatcgacatcggcctggcaccgacgccggtcgtc
tattacgccgccttccacctgcgcaccggcacctgcgtggcggtcaccggcagtcataac
ccgcccgagtacaacggcttcaaggtggtcatcggcggcgagacgctgtcaggcgatgcc
atcaccgatctctaccagcgcatcgtcgaggggcgcctggcgcaggcggccgagccgggc
gattaccagcagcgcgatgtcagtgccgactacatccagcgcatcgccgacgacgtgcag
ctggaccgcccgttgaaggtcgtggccgatgccggcaacggcgtcgccggtgcgcttgca
ccacagctgctggaagccatcggcgccgaagtcatcccgctgtactgcgatgtcgacggt
accttccccaaccatcatcccgacccgagcgagccggccaacctggaagacctggtgcag
acggtcaagcgcttcggcgccgacctcggcgtcgccttcgatggcgacggagaccggttg
ggcgtggtcaccggcgaaggcaggatcatctatgccgaccgcctgctgatgctgtttgcc
gccgatgtgctgatgcgcaaccccggcgcgatggtgatctacgacgtgaagtgcaccggc
aagctgtccgatcacgtgctgcgcaatggtggcagcccgttgatgtggaagaccgggcac
tcgctgatgaaggcgaagatgcgcgagaccgatgccgagctggccggcgagatgagcggc
cacttcttcttcaaggagcgctggttcggtttcgacgatggcctgtatgccgccgcgcga
ctgctggagatcctggcgcagcgcgaggaaaccccggacgaggtgctggccgagctgccg
gagatggtggccacgccggaactgaaggtgccggtggccgaaggcacgcctcatgcgctg
gtggcgatgctggtggcggcggcacagtcgccggacaacccgtatgtgggcggccgcctg
tcgaccatcgacggcctgcgcgtggacttccccgatggctggggcctggtgcgtgcttcc
aatactacgccggtgctggtgctgcgcttcgagggcaacgacgaggcggcactggaacgc
atccaggcgttgttccgcagccagctgcagccggtgctgggcgacaccccgctggggttc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system