KEGG   Stenotrophomonas maltophilia K279a: Smlt0598Help
Entry
Smlt0598          CDS       T00718                                 

Definition
O-antigen biosynthesis aminotransferase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sml00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
608556..610457
Genome map
AA seq 633 aa AA seqDB search
MSGVVGAWLPPAEDEHLLQQLAPMLRALQQRGRGRIGYWTDAEAGLALGHCRAPTDTPLQ
PLSSDCGRYVLCLDGRLYNRADLQSQLRDLPRSCSDARLLLQAIIEWGVERALSRIEGAF
GFSVWDRELRELWLARDPVGERPLYYGWYQGRFLFASEMKALQAFAGFAPSIDQDALSLL
LRHDYVPAPHTIYRGIHKLVAGAMLRIDLNDHAAGGSSQAAQGGSRYWCARDAMQSALQE
PLLPAPSLEQATDQLEAVLQKAIAARMHSPLACGAFLSGGTDSSLVTAMMQAQSTLPIEA
WTVGFDDPGHDESDWASQVARHLGVQHHLHRMDARQGLDLLQRLPQVWCEPFADASQLPT
LLASELLGARKPVALTGDGGDELFFGHPSYGRALRNARLCGGLPDWVRDLARRSGNRMNV
ERGRLGGWRALVAEVAANDVEGHYLQRVTRWRQPAQVVLGAREPMTIFQQQDTALPAEAR
IQLLDFRMDLAEGILAKVDRAGMAAGVETRAPLLDMEVVRLAWRLPQHLKYHDGEHKRIL
KHLLARYLPEPLVYRPKRGFGPPMARWLAGPLRDWAEALLDPQLLRNQGCFDAARVRGIW
EAFLRGERKWHTHLWNVLMFQAWHQHWHGARGR
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgtggtcggggcctggctgccgcccgccgaggacgaacacctgctgcagcag
ctggcgccaatgctgcgcgcccttcagcagcgcggccgggggcgcatcggttactggacc
gacgccgaggccggcctggcgctgggccactgccgggcgccaaccgatacgccgttgcag
cccctgagttcggactgtggccgttacgtgctgtgcctggatggccggttgtacaaccgg
gccgacctgcagtcgcagctgcgcgatctgccacgcagctgcagcgatgcgcggctgctg
ctgcaggcgatcatcgaatggggcgtggaacgggcgctttcccgcatcgagggcgcgttc
ggtttcagcgtatgggaccgcgagttgcgcgaactgtggctggcccgcgacccggttggc
gagcggccgctgtactacggctggtaccagggccggttcctgttcgcctcggaaatgaag
gcactccaggcctttgccggtttcgccccgagcatcgaccaggatgcgctgagcctgctg
ctgcgccatgactacgtgccggcaccgcacaccatctaccgcggcatccacaagctggtg
gcaggcgcgatgctgcgcatcgatctgaatgaccatgcggctggcggctccagccaggcc
gcacagggtggttcacgctactggtgcgcacgcgatgcgatgcagagcgcactgcaggaa
ccgctgctgccggcgccgagcctggagcaggcgaccgaccagctggaagctgtgctgcag
aaggccatcgccgcacgcatgcattcgccgctggcctgcggcgcgttcctgtccggcggc
accgattcctcgctggtgacggcgatgatgcaggcacagtcgacgctaccgatcgaagcg
tggacggttggcttcgacgatcccggccatgacgagagcgattgggcctcgcaggtcgcg
cggcatctgggcgtgcagcatcatctgcaccggatggacgcgcgtcagggcctggatctg
ctgcagcggctgccgcaggtctggtgcgaaccgttcgccgatgcctcgcagctgccgacc
ctgctggccagcgaactgctgggcgcgcgcaagccggtggcgctgaccggcgacggcggc
gatgaactgttcttcggccaccccagctatggccgcgcgctgcgcaatgcacgcctgtgc
ggtggcctgccggactgggtgcgtgatctggcgcggcgcagcggcaaccgcatgaatgtc
gagcgcggccgcctgggcggctggcgcgcactggtggcggaagtcgccgccaacgacgtg
gaaggtcactacctgcagcgcgtgacgcgctggcggcagccggcgcaggtggtgctgggt
gcacgcgagccgatgacgatcttccagcagcaggacacggcgctgccggccgaggcccgc
atccagctgctggatttccgcatggacctggccgagggcattctcgccaaggtcgatcgt
gcgggcatggcggcgggcgtggagacgcgcgcgccgctgctggacatggaggtggtgcgg
ttggcctggcgcctgccgcagcacctgaagtaccacgacggtgagcacaagcggatcctc
aagcacctgctggcgcgctacctgcccgagccgctggtgtatcgccccaagcgcggcttc
ggaccgccgatggcgcgctggttggcgggcccgctgcgcgactgggcggaggcactgctg
gacccgcagctgctgcgcaaccagggctgcttcgatgcggcacgcgtgcgcggcatctgg
gaagcgtttctgcggggtgagcgcaagtggcacacgcacctgtggaacgtgctgatgttc
caggcgtggcaccagcactggcacggtgctcgcgggcgctga

DBGET integrated database retrieval system