KEGG   Stenotrophomonas maltophilia K279a: Smlt0653Help
Entry
Smlt0653          CDS       T00718                                 

Gene name
xanA
Definition
(GenBank) putative phosphohexose mutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00010  Glycolysis / Gluconeogenesis
sml00030  Pentose phosphate pathway
sml00051  Fructose and mannose metabolism
sml00052  Galactose metabolism
sml00230  Purine metabolism
sml00500  Starch and sucrose metabolism
sml00520  Amino sugar and nucleotide sugar metabolism
sml00521  Streptomycin biosynthesis
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01120  Microbial metabolism in diverse environments
sml01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smlt0653 (xanA)
   00030 Pentose phosphate pathway
    Smlt0653 (xanA)
   00051 Fructose and mannose metabolism
    Smlt0653 (xanA)
   00052 Galactose metabolism
    Smlt0653 (xanA)
   00500 Starch and sucrose metabolism
    Smlt0653 (xanA)
   00520 Amino sugar and nucleotide sugar metabolism
    Smlt0653 (xanA)
  Nucleotide metabolism
   00230 Purine metabolism
    Smlt0653 (xanA)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smlt0653 (xanA)
Enzymes [BR:sml01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Smlt0653 (xanA)
    5.4.2.8  phosphomannomutase
     Smlt0653 (xanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_III PGM_PMM_II PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: CAQ44236
UniProt: B2FMQ3
Position
complement(669974..671320)
Genome map
AA seq 448 aa AA seqDB search
MPLPAFKAYDIRGRVPEELNEDLARRIGVALAAQLAPGPVVLGHDVRLTSPALQDALAAG
LRGTGREVIDIGLCGTEEVYFQTDHLGAAGGVMVTASHNPMDYNGMKLVKENARPISSDT
GLFAISDAVAADTSEAQPPRAGQTAQHDKHAYIQHLLSYVDASKLKPLKLVVNAGNGGAG
AIVDLLAPHLPFEFIRICHEPDGSFPNGIPNPLLPENRAATADAVREHGADFGIAWDGDF
DRCFFFDHSGRFIEGYYLVGLLAKAILARHPGGKIVHDPRLVWNTVDMVEQAGGVAVQCK
SGHAFIKEKMRAEDAVYGGEMSAHHYFREFAYADSGMIPWLLIAQLVSESGRSLADWVED
RMAAYPCSGEINFKVADAKAAVARVMEHFAAQSPALDHTDGISADFGNWRFNLRSSNTEP
LLRLNVEARGDAALMQARTDEISRLIQQ
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcccgctttcaaggcctacgatatccgcggccgtgtgccggaagaactgaac
gaggacctggcccgtcgcatcggcgtcgccctggccgcacagctcgctccaggcccggtg
gtcctcggacatgatgtgcgccttaccagtccggcactgcaggatgcgctggccgcaggc
ctgcgtgggaccggccgtgaggtgatcgacatcggcctgtgcggcaccgaagaggtctac
ttccagaccgatcacctcggcgcggccggcggcgtgatggtgaccgccagccacaacccg
atggactacaacggcatgaagctggtgaaggagaacgcgcggccgatcagttcggatacc
ggcctgttcgcgatttccgacgcggtcgccgccgatacctccgaggcccagccgccgcgt
gccgggcagaccgcccagcatgacaagcacgcctacatccagcatctgctgagctacgtc
gatgccagcaaactgaagccgctgaagctggtggtcaatgccggcaatggcggcgccggc
gccatcgtcgacctgctggcaccgcacctgccgttcgagttcatccgcatctgccacgag
ccggacggcagcttccctaacggcattcccaacccgctgctgccggagaaccgcgccgcc
accgccgacgcggtgcgcgaacacggtgccgacttcggcatcgcctgggacggtgacttc
gaccgttgcttcttcttcgaccacagcggccgcttcatcgagggctactacctggtcggc
ctgctggccaaggcgatcctggcgcgccatcccggcggcaagatcgtgcatgacccacgc
ctggtctggaacacggtggacatggtcgagcaggccggcggtgtcgcggtgcagtgcaag
agcggccatgccttcatcaaggaaaagatgcgtgccgaagacgcggtgtacggcggcgag
atgagcgcacaccactatttccgcgagttcgcctatgccgactcgggcatgattccgtgg
ctgctgatcgcccagctggtttccgagagcggccgttcgctggccgactgggttgaagac
cgcatggcagcctacccgtgcagcggcgagatcaacttcaaggtggccgatgccaaggcc
gccgttgcgcgcgtgatggaacacttcgccgcgcagtcgcccgcgctggaccacaccgat
ggcatcagtgccgacttcggcaactggcgcttcaacctgcgcagttccaacaccgagccg
ctgctgcgcctgaacgtcgaagcgcgtggtgacgccgcactgatgcaggcgcgtaccgac
gaaatctcccgtctgatccagcagtaa

DBGET integrated database retrieval system