KEGG   Stenotrophomonas maltophilia K279a: Smlt0655Help
Entry
Smlt0655          CDS       T00718                                 

Gene name
lpsI
Definition
succinyl-CoA:3-ketoacid-coenzyme A
Orthology
K01028  
3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sml00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sml00072]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:sml00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674892..675623
Genome map
AA seq 243 aa AA seqDB search
MQQSTFTGKRSKRFASAAEALQGVVADGQTLAVGGFGLCGIPEALIAALRDSGAKGLTVI
SNNAGVDGFGLGQLLETRQIKKMISSYVGENKEFERQFLAGELELEFNPQGTLAERLRAG
GAGIPAFFTATGYGTVVAEGKETREFDGKHYVMETALRADVALVKAWTADEAGNLVFRKT
ARNFNPACAMAGKVCIAEVEEIVPVGAIDPDQVHLPGIYVHRIVHNAHPEKRIEQRTIRA
EGN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatcgactttcaccggcaagcgcagcaagcgcttcgccagtgcggcggaggcc
ctgcaaggggtggtcgccgatggccagacgctggccgtgggcggcttcggcctgtgtggc
attcccgaggcattgatcgccgcgctgcgcgacagtggtgccaagggcctgaccgtgatc
tccaacaatgccggcgttgatggtttcggcctgggccaactgctggaaacccggcagatc
aagaagatgatttcgtcctacgtgggcgagaacaaggagttcgagcggcagttcctggcc
ggcgagctcgagctggaattcaatccgcagggcaccctggccgagcgcttgcgtgccggc
ggtgcgggtattccggcgttcttcaccgccaccggctatggcacggtggtggccgaaggc
aaggaaacccgcgagttcgacggcaagcactacgtgatggaaacagcgctgcgggccgac
gtggcgctggtcaaggcgtggacggccgacgaggccggcaacctggtgttccgcaagacc
gctcggaatttcaacccggcctgtgcgatggccggcaaggtctgcatcgccgaggtcgag
gagatcgtgccggttggcgccatcgatccggaccaggtgcacctgccgggcatctacgtg
caccgcatcgtgcacaacgcgcatcctgaaaaacgcatcgaacagcgcaccatccgcgcg
gagggcaactga

DBGET integrated database retrieval system