KEGG   Stenotrophomonas maltophilia K279a: Smlt0655Help
Entry
Smlt0655          CDS       T00718                                 

Gene name
lpsI
Definition
succinyl-CoA:3-ketoacid-coenzyme A
Orthology
K01028  
3-oxoacid CoA-transferase subunit A [EC:2.8.3.5]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Smlt0655 (lpsI)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Smlt0655 (lpsI)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smlt0655 (lpsI)
Enzymes [BR:sml01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Smlt0655 (lpsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674892..675623
Genome map
AA seq 243 aa AA seqDB search
MQQSTFTGKRSKRFASAAEALQGVVADGQTLAVGGFGLCGIPEALIAALRDSGAKGLTVI
SNNAGVDGFGLGQLLETRQIKKMISSYVGENKEFERQFLAGELELEFNPQGTLAERLRAG
GAGIPAFFTATGYGTVVAEGKETREFDGKHYVMETALRADVALVKAWTADEAGNLVFRKT
ARNFNPACAMAGKVCIAEVEEIVPVGAIDPDQVHLPGIYVHRIVHNAHPEKRIEQRTIRA
EGN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatcgactttcaccggcaagcgcagcaagcgcttcgccagtgcggcggaggcc
ctgcaaggggtggtcgccgatggccagacgctggccgtgggcggcttcggcctgtgtggc
attcccgaggcattgatcgccgcgctgcgcgacagtggtgccaagggcctgaccgtgatc
tccaacaatgccggcgttgatggtttcggcctgggccaactgctggaaacccggcagatc
aagaagatgatttcgtcctacgtgggcgagaacaaggagttcgagcggcagttcctggcc
ggcgagctcgagctggaattcaatccgcagggcaccctggccgagcgcttgcgtgccggc
ggtgcgggtattccggcgttcttcaccgccaccggctatggcacggtggtggccgaaggc
aaggaaacccgcgagttcgacggcaagcactacgtgatggaaacagcgctgcgggccgac
gtggcgctggtcaaggcgtggacggccgacgaggccggcaacctggtgttccgcaagacc
gctcggaatttcaacccggcctgtgcgatggccggcaaggtctgcatcgccgaggtcgag
gagatcgtgccggttggcgccatcgatccggaccaggtgcacctgccgggcatctacgtg
caccgcatcgtgcacaacgcgcatcctgaaaaacgcatcgaacagcgcaccatccgcgcg
gagggcaactga

DBGET integrated database retrieval system