KEGG   Stenotrophomonas maltophilia K279a: Smlt0681Help
Entry
Smlt0681          CDS       T00718                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sml  Stenotrophomonas maltophilia K279a
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701309..702091
Genome map
AA seq 260 aa AA seqDB search
MLRFAIAAVFGALSLTACAQPAPPAAKAPAAAAKPGPAANAPADQAVRAALTALNPGFKV
DYIGAAPFPGFREVVVSGQLLYVSDDGRYLFQSQPYDTRAKGPANSEGLLGYRRDLLAKA
NHGDRIVFAAPNAKYTISVFTDIECGYCRKLHQDIAELNRNGISVEYLAFPRMGLGSKDY
TDMISVWCAADRRQALTNAKRGGNVPAKNCTNPVAMQYALGQQLGVNGTPAIFAPDGTQL
GGYLPPAQLRAALEKLSAKR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctccgatttgccatcgccgccgtgttcggtgcgctcagcctgactgcctgcgcccag
ccggccccgccagccgccaaggcgcctgccgctgctgccaagcccggcccggccgccaac
gcgccagccgaccaggccgtgcgcgccgcgttgactgccctgaaccccggtttcaaggtg
gactacatcggtgccgcgccgttccccggcttccgcgaggtggtcgtttccggccagctg
ctgtacgtgtccgacgacggtcgctacctgttccagtcgcagccttacgacacccgtgcc
aagggcccggccaacagcgaaggcctgctcggctaccgccgcgatctgctggccaaggcc
aaccatggcgaccgcatcgtgttcgccgcgccgaatgccaagtacaccatcagcgtgttc
accgacatcgagtgcggctactgccgcaagctgcaccaggacatcgccgagctcaaccgc
aacggtatctccgtcgagtatctggcattcccgcgcatgggcctcggcagcaaggactac
accgacatgatctcggtctggtgtgcggccgatcgccgccaggcactgaccaacgccaag
cgcggtggcaacgtgccggcaaagaactgcaccaacccggtggcgatgcagtacgcactg
ggccagcagctgggcgtgaacggcacgccggcgatcttcgcgccggacggcacccagctg
gggggctacctgccgccggcgcagctgcgcgcggcgctggaaaaactgtcggccaagcgc
tga

DBGET integrated database retrieval system