KEGG   Stenotrophomonas maltophilia K279a: Smlt0791Help
Entry
Smlt0791          CDS       T00718                                 

Gene name
rbsK
Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Smlt0791 (rbsK)
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Smlt0791 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(832109..833074)
Genome map
AA seq 321 aa AA seqDB search
MSSSVVVVGSFNVDHVWRCESLPAPGATIAGRYSTGPGGKGFNQAVAACRAGAETHFVCA
LGDDAGGATARELAAQDGFGLIAEASSEPTGTAGIYVDARGRNTIVIGPGANAALSTDFL
QQQQALLTGARVVLVQLESPVQTIEAALATAREAGVTTVLNTAPADAPSTIGLLKLADVI
TPNETEFAALLGRHVGERVDANDVAALDGASLHALCRKLVGNGTVVVTLGSVGVFVSHAD
ENLRGDTQPYYRVGAEQVQAIDTTGAGDAFNGALAASLAQVADAPFARHVRFANQFAGRS
TEKEGAAAAMPRFTPADAEAK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcagtgtcgttgtcgtcggttccttcaatgtcgatcacgtgtggcggtgcgag
tcgctgccggcaccgggcgcgaccattgccggccgctacagcaccggccccggtggcaag
ggcttcaaccaggccgtggcggcctgccgcgccggtgccgagacgcacttcgtgtgcgcg
ctgggcgacgacgccggtggcgccaccgcgcgcgaactggcggcgcaggatggtttcggc
ctcatcgccgaagccagcagcgaaccgaccggcaccgccggcatctacgtcgatgcccgt
ggccgcaacaccatcgtgatcggcccgggtgccaacgctgcgctgagcaccgacttcctg
caacagcagcaggccctgttgaccggcgccagggtggtgctggtgcagctggaatcgccg
gtgcagaccatcgaagcggcactggccacggcccgcgaggccggcgtcaccaccgtgctc
aacaccgcaccggccgatgccccctcgaccatcggcctgctcaagctggccgatgtgatc
accccgaacgagaccgagttcgctgccctgctcggccgccatgtcggtgagcgggtggat
gccaacgacgtcgccgcgctggatggcgccagcctgcacgcgctgtgccgcaagctggtc
ggcaacggtaccgtggtggtcaccctgggttcggtgggcgtgttcgtgtcgcatgccgac
gagaacctgcgcggcgatacccagccgtactaccgcgtgggtgccgaacaggtgcaggcg
atcgacaccaccggtgccggtgacgccttcaacggtgcgctggccgcgtcgctggcgcag
gtggccgacgccccgttcgcccgccacgtgcgcttcgccaaccagttcgccggtcgttcg
accgagaaggaaggtgctgcagcggcgatgccgcgcttcaccccggccgacgccgaagca
aagtag

DBGET integrated database retrieval system