KEGG   Stenotrophomonas maltophilia K279a: Smlt0800Help
Entry
Smlt0800          CDS       T00718                                 

Definition
acyl-CoA thioesterase I (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Smlt0800
Enzymes [BR:sml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Smlt0800
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Smlt0800
Lipid biosynthesis proteins [BR:sml01004]
 Fatty acid synthase
  Component type
   Smlt0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
843424..844068
Genome map
AA seq 214 aa AA seqDB search
MRKTGWSRRAGAMMVLLLGFLLLPGLACAKGPAGTVLVLGDSLSAAHNIPADAGWVSLLQ
QRVRQQSKTPARIVNASMSGETTAGALTRLPALLAKEKPTVVVIALGGNDALRGLTPAQV
QGNLGKMVQASQKAGAKVLLLGIDVPPNYGPAYRQRLAAAYRALATQYKVPLLPFLLEGV
ALQPGMMQADGLHPTAQAQPKVLDNVWPLLRPLL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagacgggatggagccggcgagccggcgcgatgatggtgctgctgctagggttc
ctgctgttgccggggctggcctgtgccaaaggtccggccggcaccgtgctggtgctcggc
gacagcctcagtgctgcccacaatatccctgccgacgccggctgggtcagcctgctgcag
cagcgggtcaggcagcagtcgaaaaccccggcgcgcatcgtcaacgccagcatgagcggc
gagaccaccgccggcgcactcacccgcctgccggccctgctggcgaaggaaaagccgacc
gtggtagtgatcgcccttggcggcaacgacgcactgcgcgggctgaccccggcgcaggtg
cagggcaacctgggaaagatggtgcaggccagccagaaggccggcgcgaaggtgctgctg
ctgggcattgacgtgccgcccaactacgggccggcctatcgccagcgcctggctgcggcc
tacagggcgctggccacgcagtacaaggtgccgctgctgcccttcctgctggagggggtg
gccctgcagccgggcatgatgcaggccgacggcctgcacccgaccgcacaggcgcagcca
aaggtgctggacaacgtctggccgctgctcaggccgctgctctga

DBGET integrated database retrieval system