KEGG   Stenotrophomonas maltophilia K279a: Smlt1016Help
Entry
Smlt1016          CDS       T00718                                 

Gene name
recR
Definition
(GenBank) putative recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sml00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Smlt1016 (recR)
DNA repair and recombination proteins [BR:sml03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Smlt1016 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Smlt1016 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1074265..1074864
Genome map
AA seq 199 aa AA seqDB search
MSAPLLEQLIDALRVLPGVGQKTAQRMAYHLLEREREGGQRLAETLALAVERIGHCVQCR
DFSETELCPTCANGSRERSQLCVVESPADRLAIENATGFRGVYFVLQGRLSPLDGIGPRE
LGLEQLERRLAEGEVQELIIATSATVEGEATAHYLAQLARARKVQPSRLAQGLPLGGELE
YVDRGTLSHAFGTRSEFRD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcacccctgcttgaacaattgatcgacgcattgcgggtgctgcctggcgtcggc
cagaagactgcacagcgcatggcctatcacctgctcgagcgcgagcgcgaaggtggccag
cgtctggccgagacactggcattggcggtggagcgaatcggccactgcgtgcagtgccgc
gatttcagcgaaaccgagctgtgcccgacctgtgccaacggcagccgcgagcgcagccag
ctgtgcgtggtcgaatcgccggccgaccgcctggccatcgagaacgccaccggcttccgc
ggtgtctacttcgtgctgcaggggcggctgtcgccgctcgatggcatcggcccgcgcgag
ctgggcctggagcaattggagcgacggttggccgaaggcgaggtgcaggagctgatcatc
gccaccagcgccactgtcgagggcgaggccaccgcgcactacctggcgcagctggcgcgc
gcacgcaaggtgcagccgagccgtttggcgcagggcctgccacttggcggtgaactcgaa
tacgtcgatcgcggcacgctctcgcacgcgttcggaacgcgcagcgaattccgcgattga

DBGET integrated database retrieval system