KEGG   Stenotrophomonas maltophilia K279a: Smlt1100Help
Entry
Smlt1100          CDS       T00718                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sml00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sml00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1148891..1149841
Genome map
AA seq 316 aa AA seqDB search
MTAQQIDASGRLRHLLTLEGLPRETLLQLLDRAGQIRDAAVGRVGNKRQVLAGSAVCTLF
FEPSTRTRSSFQLAAQRLGADVLNFDASTSSTRKGETACDTLRNLEAMGVRGFVVRHPDD
GAVAALADAAGEGTALINAGDGRSSHPTQGLLDMLTLRQAKGPDFSKLKVVIVGDVKHSR
VARTDLHALRTLGVGEIRVCGPQSLLPDDETLKGCVVGDDFDAMLEGVDALMMLRLQRER
MEEGLVPSLEQYHAQYGLTNERLARAGKDAAVLHPGPINRGVEVTDEVADGPQSWVLRQV
ANGVAVRMAVLETLLG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagcaaatcgatgcctccggacgcctgcgccacctgctgaccctggagggc
ctgccgcgcgaaacgctgcttcagctgctcgaccgcgcagggcagatccgcgatgccgca
gtgggccgcgtcggcaacaagcgccaggtgctggccggttcggcggtgtgcacgctgttc
ttcgaaccgtccacgcgcacccgcagttcgttccagctggccgcgcagcggctgggggcg
gacgtgctgaatttcgacgcctccacctcctctacccgcaagggtgagaccgcctgcgac
acgcttcgcaacctggaagcgatgggcgtgcgcggcttcgtggtgcgccaccccgatgac
ggcgccgtggccgcactggccgatgcggcaggcgagggcaccgcgctgatcaatgccggt
gacggccgcagttcgcacccgacccagggcctgctggacatgctgaccctgcgccaggcc
aagggcccggatttctcgaagctgaaagtcgtgatcgtcggcgacgtaaagcactcgcgc
gtggcccgtaccgacctgcatgcgctgcgcacgctgggcgtgggcgagatccgcgtgtgt
ggcccgcagtcgctgctgccggacgacgagaccctgaagggctgcgtggtcggcgatgat
ttcgacgcgatgctggaaggcgtcgatgcgctgatgatgctgcgcctgcagcgcgagcgc
atggaagaaggcctggtgccgtcgctggagcagtaccacgcgcagtacggcctgaccaac
gaacgcctggcgcgcgcgggcaaggatgccgcggtgctgcacccgggcccgatcaaccgc
ggcgtggaagtgaccgacgaggtggccgacggcccgcaatcgtgggtgctgcgccaggtc
gccaacggcgtcgccgtgcgcatggccgtgctggaaaccctgctgggctga

DBGET integrated database retrieval system