KEGG   Stenotrophomonas maltophilia K279a: Smlt1119Help
Entry
Smlt1119          CDS       T00718                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sml00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sml00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1164470..1165741
Genome map
AA seq 423 aa AA seqDB search
MAKIVVTGGAALHGEVSISGAKNAVLPILCATLLADEPVEITNVPHLHDVVTTVKLLGEL
GAKVTIDQGTLSRGSAIVVDPRPVNQHVAPYELVKTMRASILVLGPLLARFGAAEVSLPG
GCAIGSRPVDQHIKGLQALGAEIVVENGFIKASAKRLKGGHFTFDMVSVTGTENVLMGAV
LAEGTTVLDNCAMEPEVTDLAHCLIALGAKIEGLGTARLVIEGVERLSGGRHEVLPDRIE
TGTFLVAAAMTGGKVTVNRARPNTMDAVLSKLVEAGAKIETTDDSITLDMQGRRPKAVNL
TTAPYPAFPTDMQAQFMALNCVADGVGVINETIFENRFMHVNELLRLGADIQVEGHTAIV
RGSEHLSGAPVMATDLRASASLILAGLMASGDTTIDRIYHLDRGYENIEEKLSSLGATIR
RVP
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggccaagatcgttgtgaccggcggcgctgcgctgcacggtgaagtgagcatctccggc
gccaagaacgccgtcctccccattctctgcgcgaccctgctggccgatgagccggtggag
atcaccaacgtgccgcacctgcacgacgtggtcaccacggtgaagctgcttggcgagctg
ggcgccaaggtcaccatcgaccagggcacgctgtcgcgcggcagcgcgatcgtggtcgac
ccgcgtccggtcaaccagcacgtcgcaccgtatgagctggtcaagaccatgcgcgcctcg
atcctggtgctgggcccgctgctggcccgcttcggcgccgccgaagtgtcgctgccgggc
ggctgcgcgatcggctcgcgaccggtcgaccagcacatcaagggcctgcaggcgctgggc
gccgagatcgtggtcgagaacggcttcatcaaggccagcgccaagcgcctgaagggtggc
cacttcaccttcgacatggtcagcgtcaccggcaccgagaacgtgctgatgggcgcggtg
ctggctgaagggaccaccgtcctcgacaactgcgcgatggaaccggaagtgaccgacctg
gcgcactgcctgatcgcgctgggcgcgaagatcgaaggcctgggcaccgcccgcctggtg
atcgagggcgtcgagcgcctgtccggtggccgccacgaagtgctgcccgaccgcatcgag
accggcaccttcctggtggccgcggcgatgaccggtggcaaggtcacggtcaaccgtgcg
cgcccgaacaccatggacgcggtgctgtccaagctggtcgaggccggtgcgaagatcgag
accaccgacgacagcatcaccctggacatgcagggcaggcggccgaaggcggtcaacctg
accaccgcgccgtacccggcattcccgaccgacatgcaggcgcagttcatggcactcaac
tgcgtggccgatggcgtgggcgtgatcaacgaaacgatcttcgagaaccgtttcatgcac
gtcaacgaactgctgcgcctgggcgcggacatccaggttgaaggccacactgccatcgtg
cgtggcagcgagcacctgagcggcgcaccggtgatggcgaccgacctgcgtgcgtcggcc
tcgctgatcctggccggcctgatggccagcggcgataccaccatcgaccgcatctaccac
cttgatcgcggctacgagaacatcgaagagaagctgtcttcgctcggcgccaccatccgg
cgcgtgccatga

DBGET integrated database retrieval system