KEGG   Stenotrophomonas maltophilia K279a: Smlt1518Help
Entry
Smlt1518          CDS       T00718                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00300  Lysine biosynthesis
sml01100  Metabolic pathways
sml01120  Microbial metabolism in diverse environments
sml01230  Biosynthesis of amino acids
Module
sml_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Smlt1518 (dapE)
Enzymes [BR:sml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Smlt1518 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: CAQ45054
UniProt: B2FIC0
Position
1574413..1575540
Genome map
AA seq 375 aa AA seqDB search
MSAVLDLTCELIARPSVTPDDAGCQALLAARLKQAGFQCDHLRLGDVDNLWATHGLGAPV
LVLLGHTDVVPTGPRESWTSDPFTPHIRDGVLYGRGAADMKGSVAAFVVAAEQFVADHPD
HPGTLAVLLTSDEEGDAIDGVRHVARLFAARGQRIDWCITGEPSSTATLGDLLRVGRRGS
LSAKLRVQGVQGHVAYPEKARNPIHQAAPALAELCARRWDDGYESFPPTSLQISNIHAGT
GANNVIPGELDVDFNIRYNPHWDAPKLEAEITALLERHGLQYTLKWHRSGEPFYTPEGTL
RAIARAVLAEHIGRAPEESTGGGTSDARFIAPLGAQCIEVGPVNASIHQVDENVRVDDLE
ALPGLYQRLVERLLV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggtcctcgacctgacctgcgagctgattgcgcgaccttcggtaacgccggac
gatgctggttgccaggcgctgttggcggcgcggctgaagcaggccggattccagtgcgat
catctgcgcctgggcgacgttgacaatctgtgggcgacccatggcctgggcgcgccggtg
ctggttctgctgggccacactgacgtggtgcccaccggcccgcgcgagtcctggaccagc
gacccgttcaccccacatatccgcgatggcgtgctgtatgggcgcggtgccgccgacatg
aaaggcagcgtggcggcgttcgtggtggccgccgagcagttcgtcgccgaccatcccgac
catcccggcacgctggcggtactgctgaccagcgacgaggagggcgatgccatcgatggc
gtgcgccacgttgcacgcctgttcgccgcacgcgggcagcgcatcgactggtgcatcacc
ggtgagccgtcgtcgaccgcgacgctgggcgatctgctgcgcgtgggacgtcgcggcagc
ctgtcggccaaactgcgcgtccaaggcgtgcagggccacgtggcgtatccggaaaaggca
cgcaacccgattcaccaggcggcgccggccctggcagaactatgcgcgcggcgctgggac
gacggctacgagagtttcccgccgaccagcctgcagatctccaacatccacgccggcacc
ggtgccaacaacgtgattcccggtgagctcgacgtggatttcaacatccgctacaacccg
cactgggatgcgccgaagctggaggcggagatcaccgcactgctggaacggcatggcctg
cagtacacgctgaagtggcatcgcagcggcgagccgttctacaccccggaaggcacgctg
cgcgccatcgcccgtgcggtgctggccgagcacatcggccgcgcgccagaagaaagcacc
ggcggcggcacctccgatgcacgcttcatcgcgccattgggcgcgcaatgcatcgaagta
ggcccggtcaatgccagcatccaccaggtggacgagaatgtgcgcgtggacgatctggaa
gcgttgccggggctgtaccagcggctggtggaacggctgctggtgtga

DBGET integrated database retrieval system