KEGG   Stenotrophomonas maltophilia K279a: Smlt1722Help
Entry
Smlt1722          CDS       T00718                                 

Gene name
pcm
Definition
L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sml  Stenotrophomonas maltophilia K279a
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1768226..1768903
Genome map
AA seq 225 aa AA seqDB search
MSPRLRLQPEAVGIGMTSQRVRDRLVDRLREAGIVDESTLNAIRVVPRHLFIDEALASRA
YEDTALPIGHGQTISQPWVVARMTEAVLQVSPKKVLEVGTGSGYQAAVLGALGLEIYTVE
RIGDLLRQARKRFRALGMNIRTKHDDGRAGWAEHGPFDAIVVTAAAPALVDELVGQLAEG
GRLVAPVGGPGGQSLVQLDRRADGSIEQRVLAPVTFVPLLSGMLD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgagtccacgcctgcgcctgcaaccggaagccgtcggcatcggcatgacctcgcagcgt
gtgcgcgaccgcctggtcgatcgcctgcgcgaggctggcatcgtcgacgagtcgaccttg
aatgcgatccgggtggtgccacgtcatctgttcatcgacgaagcgctggcgtcacgcgcc
tacgaagacaccgccctgccgatcggccacggccagaccatctcgcagccgtgggtggtg
gcgcgcatgaccgaagccgtgctgcaggtctcgccgaagaaagtgctggaagtcggtacc
ggctccggctaccaggccgccgtgctcggcgcgctgggcctggagatctacaccgtcgaa
cgcatcggcgacctgctgcgacaggcgcgcaagcgcttccgtgcgctgggcatgaatatc
cgcaccaagcatgatgatggccgcgcgggctgggccgagcacggcccgttcgatgccatc
gtcgtcaccgccgcggcgcctgcactggtcgatgaactggtcgggcagctggccgagggc
ggccgcctggtggcgccggtcggcgggccgggtgggcagtcgctggtgcagctggaccgc
agggctgacggcagcatcgaacaacgcgtgcttgcgccggtcaccttcgtgccgctgctg
tccggcatgctcgactaa

DBGET integrated database retrieval system