KEGG   Stenotrophomonas maltophilia K279a: Smlt1734Help
Entry
Smlt1734          CDS       T00718                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sml00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1776649..1777545
Genome map
AA seq 298 aa AA seqDB search
MFDTSPQLDCAGRILRLDRARVMGIVNVTPDSFSDGGAHDTTEAAVAHGLKLVEEGADLL
DIGGESTRPGAAPVSVEEELRRVIPVIEQLAARTRVPISIDTFKPEVMRAAVAAGAGMIN
DIYGLRQEGALDAAAATGVPVVLMHMQGEPGHMQADPHYDDVVAEVHGFLVQRLFAAEMA
GFAKKNLLIDLGFGFGKTTAHNMTLLARSERFLELGVPMLAGLSRKRSLGELTGRDTPSE
RVAASVAAHLIAVQRGARIVRVHDVAATVDALKIWQAVEAVPTPRADATPTIRWPDED
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatacctcgccccagctcgattgcgccggccgcatcctgcgcctcgaccgtgcc
cgggtcatgggcatcgtcaacgtcaccccggactccttctccgatggcggcgcgcacgac
accaccgaggctgcggtcgcccatggcctgaagctggtcgaggagggcgcggacctgctg
gacatcggcggcgaatcgacccggccgggcgctgcgccggtatcggtggaggaggaactg
cgccgggtgattccggtgatcgagcagctggccgcacgcacccgggtgccgatcagcatc
gacaccttcaagccggaagtgatgcgcgcggccgtggcggctggcgctggcatgatcaat
gacatctacggactgcgtcaggaaggggcgctggacgccgccgctgcaaccggcgtgccg
gtggtgctgatgcacatgcagggcgagccaggccacatgcaggccgatccacattacgac
gacgtggtcgccgaggtgcacggcttcctggtccagcgcctgttcgctgccgagatggcg
ggctttgcgaagaagaacctgttgatcgatctcggtttcggtttcggcaaaaccaccgcc
cacaacatgaccctgctggcacgctccgagcggttcctggagctgggcgtgccgatgctg
gctggcctgtcgcgcaagcgcagcctgggcgaactgaccggtcgcgacacgccgtccgag
cgcgtggccgcctcggtggccgcgcacctgatcgcggtgcagcgtggcgcacgcatcgtg
cgcgtgcatgacgtggccgccaccgttgatgcattgaagatctggcaggcagtcgaggcc
gtgccaacgccgcgcgccgacgccacgccgacgatccgctggccggacgaagactga

DBGET integrated database retrieval system