KEGG   Stenotrophomonas maltophilia K279a: Smlt1778Help
Entry
Smlt1778          CDS       T00718                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Smlt1778
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Smlt1778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1828113..1828598
Genome map
AA seq 161 aa AA seqDB search
MTPAWIGLGANLGDAATTVGAAITALDGLPGTRVLQASRLYATPAWGNEDQPPFVNAVAA
VETSLAADELLQAMLALEQGFGRVRDAAVHWGPRALDLDLLLYGAQVLDQPGLQVPHPYM
HERAFVLVPLAEIAPDLAIPGHGRVRDAVMRVDACGIAPIG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacgccagcgtggatcggcctcggcgccaacctcggcgatgcggccacgactgtcggc
gcggcgatcactgcgctggacggcctgcctgggacccgcgtgctgcaggcctcgcgcctg
tacgcaacgccggcctggggcaatgaagaccagccaccgttcgtcaacgcggtggccgcg
gtcgaaacgtcactggcagccgatgaactgctgcaggcgatgctggcgctggagcagggc
tttggccgcgtgcgtgatgcggcggtgcactgggggccgcgcgcgctggacctggacctg
ctgctgtatggcgcgcaggtgctcgaccagcccggcctgcaggtgccgcacccctacatg
cacgagcgtgccttcgtgctggtgccgctggccgaaatcgcgccggatctggccatcccc
gggcatggccgcgtgcgggatgcagtgatgcgggtggatgcctgcgggatcgcgccgata
gggtga

DBGET integrated database retrieval system