KEGG   Stenotrophomonas maltophilia K279a: Smlt1778Help
Entry
Smlt1778          CDS       T00718                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sml00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1828113..1828598
Genome map
AA seq 161 aa AA seqDB search
MTPAWIGLGANLGDAATTVGAAITALDGLPGTRVLQASRLYATPAWGNEDQPPFVNAVAA
VETSLAADELLQAMLALEQGFGRVRDAAVHWGPRALDLDLLLYGAQVLDQPGLQVPHPYM
HERAFVLVPLAEIAPDLAIPGHGRVRDAVMRVDACGIAPIG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgacgccagcgtggatcggcctcggcgccaacctcggcgatgcggccacgactgtcggc
gcggcgatcactgcgctggacggcctgcctgggacccgcgtgctgcaggcctcgcgcctg
tacgcaacgccggcctggggcaatgaagaccagccaccgttcgtcaacgcggtggccgcg
gtcgaaacgtcactggcagccgatgaactgctgcaggcgatgctggcgctggagcagggc
tttggccgcgtgcgtgatgcggcggtgcactgggggccgcgcgcgctggacctggacctg
ctgctgtatggcgcgcaggtgctcgaccagcccggcctgcaggtgccgcacccctacatg
cacgagcgtgccttcgtgctggtgccgctggccgaaatcgcgccggatctggccatcccc
gggcatggccgcgtgcgggatgcagtgatgcgggtggatgcctgcgggatcgcgccgata
gggtga

DBGET integrated database retrieval system