KEGG   Stenotrophomonas maltophilia K279a: Smlt1792Help
Entry
Smlt1792          CDS       T00718                                 

Gene name
glk
Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00010  Glycolysis / Gluconeogenesis
sml00052  Galactose metabolism
sml00500  Starch and sucrose metabolism
sml00520  Amino sugar and nucleotide sugar metabolism
sml00521  Streptomycin biosynthesis
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01120  Microbial metabolism in diverse environments
sml01130  Biosynthesis of antibiotics
sml01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smlt1792 (glk)
   00052 Galactose metabolism
    Smlt1792 (glk)
   00500 Starch and sucrose metabolism
    Smlt1792 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Smlt1792 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smlt1792 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Smlt1792 (glk)
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smlt1792 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: CAQ45313
UniProt: B2FL80
Position
complement(1841601..1842608)
Genome map
AA seq 335 aa AA seqDB search
MSANSQPVLVADIGGTNARFALADTSLDAPLLKESIREYAVAEFPSLGDAARHHLEQIGA
AASRGVFAVAGRVDGDEARITNHPWVISRSRTAAMLGFDELHLINDFAAQAMAISLLQPE
DVVQVGGAAWVPGKPGQPRNYAVIGPGTGLGVGGLILRHGRCYPLETEGGHVSFPPGTPE
EIRILEILSEQFGRVSNERLICGPGLVNIHRAVCEMAGIDPGQLQPVDVTARALHGDPQA
MRTVDVFCAVFGAIAGDLVLTQGAWDGVFLTGGLTPKMLDSLQHSGFRQRFEHKGRFSSI
MARVPSLAVMHPHAGLLGAAAYAADAERDAPGVAA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccaactcgcagccggtgctggtcgccgacatcggtggcaccaacgcccgcttc
gccctggcggacacctcgctggacgcgccattgctgaaggagagcatccgcgagtacgca
gtggcggagttcccgtcgcttggcgatgccgcccgccatcaccttgagcagatcggcgct
gccgccagccgcggcgtgttcgcggtggccggccgcgtagacggtgacgaggcacgcatc
accaatcatccgtgggtgatctcgcgcagccgcaccgcggcgatgcttggttttgacgag
ctgcacctgatcaacgacttcgccgcacaggcaatggcgatctcgctgctgcaacccgag
gacgtggtccaggtcggtggcgccgcctgggtcccgggcaagccgggccagccacgcaac
tatgcggtgatcgggcccggtaccgggctcggcgtcgggggcctgatcctgcgccacggc
cgctgctacccgctggaaaccgaaggcggccatgtcagcttcccgccgggaacgccggag
gagatccgcatcctggagatcctgtccgagcagttcggccgcgtctccaatgagcgcctg
atctgtggccccggcctggtcaacatccatcgcgcggtgtgcgagatggccggtatcgac
ccgggccagctgcagccggtggacgtgaccgcccgcgccctgcatggcgatccgcaggca
atgcgcaccgtcgatgtgttctgcgccgtgttcggcgccattgccggcgacctggtactg
acccagggcgcctgggacggcgtgttcctcaccggtggactgaccccgaagatgctcgat
tcgctgcagcactccgggttccgccagcgcttcgaacacaaggggcggttctcttcgatc
atggcgcgggtgccgtcgctggccgtgatgcatccccatgccggactgctgggcgccgcc
gcctatgccgccgatgccgaacgtgacgcacctggagttgccgcatga

DBGET integrated database retrieval system