KEGG   Stenotrophomonas maltophilia K279a: Smlt2049Help
Entry
Smlt2049          CDS       T00718                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Smlt2049 (galU)
   00052 Galactose metabolism
    Smlt2049 (galU)
   00500 Starch and sucrose metabolism
    Smlt2049 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Smlt2049 (galU)
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Smlt2049 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2074347..2075225
Genome map
AA seq 292 aa AA seqDB search
MSKRIRKAVFPVAGLGTRFLPATKTVPKEMLPIIDRPLIQYAVDEAIEAGCDTLVFITNR
YKHAVADYFDKAYELEQKLERAGKQEQLELIRHVLPNGVRAIFVTQAEALGLGHAVLCAK
AVIGDEPFAVLLPDDLIWNRGDSALKQMADLNEASGASVIAVEDVPHDKTASYGIVATEA
FDGRKGRISQIVEKPKPEDAPSDLAVVGRYVLSPKIFELLEQTGSGAGGEIQLTDAIAQL
LKTEEVDAYRFEGTRFDCGTHLGLVEATIRFALDNPKLAGPAREKLTAMLAE
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgaattcgcaaagcagttttccccgtagcgggtttggggacgcgttttttg
ccagcaaccaagaccgtgccgaaggagatgctgccgatcattgaccggccgctgatccag
tacgcagtggacgaagcaatcgaggccggctgtgacacgctggtgttcatcaccaaccgc
tacaagcacgcggtcgccgactacttcgacaaggcctacgagctggagcagaagctcgag
cgcgccggcaagcaggagcagctggagctgatccgtcacgtgctgcccaatggcgtgcgc
gcgatcttcgtgacccaggccgaggcgctgggcctgggccatgcggtgctgtgtgccaag
gccgtgatcggtgacgagccgttcgcggtgctgctgccggacgacctgatctggaaccgc
ggcgacagtgcgctgaagcagatggccgatctcaacgaagccagcggcgccagcgtcatt
gccgttgaagatgtgccgcacgacaagaccgccagttacggcatcgtcgcgaccgaggcc
ttcgatggccgcaagggccgtatttcgcagatcgtggagaagccgaagccggaggacgcg
ccgagcgacctggccgtggtcggccgctacgtgctgagcccgaagatcttcgagctgctg
gagcagaccggcagcggtgccggcggcgagatccagctgaccgatgcgatcgcgcagctg
ctgaagaccgaagaggtggatgcctaccgtttcgagggcactcgtttcgactgcggtacg
cacctggggctggtggaagcgacgatccgcttcgcgctggacaacccgaagctggccggc
ccggcgcgggagaagctgacggcgatgttggcggaataa

DBGET integrated database retrieval system