KEGG   Stenotrophomonas maltophilia K279a: Smlt2158Help
Entry
Smlt2158          CDS       T00718                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smlt2158 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smlt2158 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Smlt2158 (thrC)
Enzymes [BR:sml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Smlt2158 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2175162..2176448
Genome map
AA seq 428 aa AA seqDB search
MQFVSTRGQSPAVGLSAAIAAGLAPDGGLYVPQVLPAARELRAGATLADTAADLLAPFFS
GDALESALPSICREAFDFPVPLRPLGGGDHVLELFHGPTAAFKDIGARFLAGTLSRLQAG
KDRDLTIVVATSGDTGAAVAAAFHRQPGVRVVVLYPDGRVSPRQAHQLGCFGDNIQALRV
AGAFDDCQAMVKQALADRELQAQVPLSSANSISLGRLLPQMSYYAHAALSHYATHRRRLN
LVVPTGNLGNAMAAVLARALGVPIGQIVLATNANAVLPAYFNGGDYQPQASVATVANAMD
VGAPSNFERLRWLYLGDDAELRAAFRAFAVDDVTIRATIAAAHASNGELFCPHTATAVKV
LQDLRARGAKGDWAVVATAHPAKFEAVVEPLIGEAVAVPPALDALLQRPAHAEPLAAEYA
ALREVLLR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgtttcgacccggggtcagtccccggccgttggcctcagtgcggcgatcgct
gcaggattggcgcccgatggagggctgtatgttccgcaggtgctgccggcggcacgtgag
ctgcgggccggcgcaacgctggccgataccgccgccgatctgctggcaccgttcttttcc
ggcgacgcgctggagtctgcgttgccgtcgatctgccgcgaggcgttcgactttccggtg
ccgctgcgtccactgggcggcggtgaccatgtgctggagctgttccatgggccgacggcg
gcgttcaaggatatcggtgcgcgcttcctggccggaacactgtcgcggctgcaggccggc
aaggaccgcgatctgacgattgttgtcgccacgtctggcgataccggcgccgccgttgct
gcggccttccatcgccagcccggcgtgcgcgtggtggtgctgtatccggatggccgcgtg
tcaccgcgccaggcgcatcagctcggttgtttcggcgacaacatccaggcgctgcgcgtg
gccggtgccttcgacgattgccaggcgatggtcaagcaggcactggctgaccgcgaactg
caggcgcaggtgccgctgagttcggccaacagcatcagcctcggccgcctgctgccgcag
atgagttattacgcgcatgcggcgttgtcccattacgcgacgcatcgtcgccggctcaac
ctggtggtgccgaccggcaaccttggcaatgcgatggcggccgtgctggcgcgcgcgctg
ggcgtgccgatcgggcagatcgtgctggccaccaatgccaatgcggtactgccggcgtac
ttcaatggcggcgactaccagccgcaggccagcgtggccaccgtggccaatgcaatggac
gtaggggcgcccagcaactttgaacgcctgcgctggctttacctcggagatgacgccgag
ctgcgcgctgcgttccgcgcgttcgcggtggatgacgtgaccatccgcgcgacgattgcg
gcggcgcatgccagcaacggcgaactgttctgcccgcatacggccacagcggtgaaggtg
ctgcaggacctgcgtgcgcgcggcgccaagggcgactgggcggtggtggctaccgcacat
ccggccaagttcgaggcagtggtggagcccttgattggcgaagcagtggccgtgccgccg
gcgctggatgcgttgctgcagcggcccgcgcacgcggaaccgttggctgcggagtatgcg
gcgttgcgtgaggtgttgctgcgttga

DBGET integrated database retrieval system