KEGG   Stenotrophomonas maltophilia K279a: Smlt2163Help
Entry
Smlt2163          CDS       T00718                                 

Gene name
hisD
Definition
(GenBank) putative histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00340  Histidine metabolism
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01230  Biosynthesis of amino acids
Module
sml_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Smlt2163 (hisD)
Enzymes [BR:sml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Smlt2163 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAQ45662
UniProt: B2FPL9
Position
2180417..2181712
Genome map
AA seq 431 aa AA seqDB search
MNRLIWSRLDEAARSAALTRPVQTVAQQTRDAVATLIAQVRGQGDDALRAITARFDGVEL
PSFEVSEAEFAAADAAVPAELRQAMVEAAERIARFHAAGMGTGYAVETAPGVVCERMLRP
IGRVGLYVPAGSAPLPSTALMLGVPAQLAGCPQVVLCTPPRADGTADPAVLVAARLTGVQ
RVFKLGGAQAIAAMAYGTASIPACDKLFGPGNSFVTEAKQQVAQDGAAAIDMPAGPSEVL
VIADAGANPAFVAADLLSQAEHGPDSQVLLLTDDTAMLAAVEAEVERQVALLPRQQIARQ
ALSASRLIQVDSLDEAFAISNRYAPEHLILALRDPRAWLDKVQAAGSVFLGDYTPEALGD
YCSGTNHVLPTAGAARAYSGVSVASFQNLISVQSASAAGLAAIGGCARIIASAEGLDAHE
RAVAVRMEVAA
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtctgatctggtcccgacttgatgaggccgcgcgcagtgcggcactgacccgc
ccggtgcagaccgtggcgcagcagacccgcgatgcggtggctacgctgattgcacaggtg
cgcgggcagggcgatgacgcgctacgtgcgattaccgcacgtttcgacggcgtcgagctg
ccatcgttcgaagtgagcgaagccgagttcgcagcggccgatgccgccgtccccgccgag
ctgcgccaggcgatggtcgaagctgccgaacgcatcgcccgtttccacgccgccggcatg
ggtacggggtatgccgtggaaaccgcaccgggcgtggtatgcgaacgcatgctgcgcccg
atcggccgggtgggcctgtatgtgccggccggcagcgcaccgctgccgtccaccgcgttg
atgctgggcgtgcccgcgcagctggccggctgcccgcaggtggtgctgtgcacgccgcca
cgcgccgacggcacggccgatcctgcggtgctggtggccgcacgcctgaccggtgtgcag
cgcgtgttcaagctgggcggcgcccaggccatcgctgcgatggcttacggcacggccagc
attccggcctgtgacaagctgttcgggccgggcaacagcttcgtcaccgaagccaagcag
caggtcgcacaggacggcgccgccgccatcgacatgccggccggtccctccgaagtgctg
gtgattgccgatgcaggtgcaaacccggcgttcgttgcagccgacctgctgtcgcaggcc
gagcacggcccggattcgcaggtgctgctgctgaccgacgataccgcgatgctggcggcg
gtcgaggctgaagtcgagcgccaggtggccttgctgccgcgccagcagatcgcacgccag
gcgctgtcggcctcgcggctgatccaggtcgactccttggacgaagccttcgcgatcagc
aaccgctatgcaccggaacacctgatcctggcattgcgtgatccgcgtgcgtggctggac
aaggtgcaggcggccggctcggtgttcctgggtgattacacccccgaggcactgggcgac
tactgcagcggcaccaaccacgtgctgcccaccgcgggtgccgcacgtgcctacagtggt
gtcagtgtggccagcttccagaacctgatcagcgtgcagagcgccagcgccgccggcctg
gcagcgattggcggctgcgcgcgcatcatcgccagtgccgaaggcctggatgcacatgaa
cgtgcggtcgcagtgcgcatggaggtggcagcatga

DBGET integrated database retrieval system