KEGG   Stenotrophomonas maltophilia K279a: Smlt2172Help
Entry
Smlt2172          CDS       T00718                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smlt2172
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smlt2172
   00052 Galactose metabolism
    Smlt2172
   00500 Starch and sucrose metabolism
    Smlt2172
   00520 Amino sugar and nucleotide sugar metabolism
    Smlt2172
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smlt2172
   00524 Butirosin and neomycin biosynthesis
    Smlt2172
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smlt2172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2188732..2189754
Genome map
AA seq 340 aa AA seqDB search
MTIAAASPVSSDSARGGLPRRLVVADVGGTFARLALAETQPGQAPLLGSHRTYACAEHPS
LAAILADFTAGLDQPVQTAVVAIAGLLDGDVLINSNLPWTVLLSTTRAQSGLHELQLIND
FEAVALAIPYLQPDTLVPLNGDADPAQAFPALVLGAGTGLGAALRFADGERPVLASEIGH
AALGAGNALELQVLGKLLQRWAHVDNERVLSGSGLMNLYPCLCELRGVTPVWTSTEALIG
AARSGEDALAVETLQVFCAWLGSLAGDAAIAVGARSVYLAGGISAHVQDFLADGRFRERF
LNKGVLTEVLRQVPVWRVEHGQLGVLGAAVWHAARQPTHD
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcgcagcagcgtccccggtttcctccgactccgcccgcggcggtcttccacgc
cgtctggtcgttgccgatgtcggcggcaccttcgcccgccttgcgctggctgaaacccaa
cccggccaggcgccgctgctgggcagccatcgcacctacgcctgcgccgagcatcccagc
ctggcggcgatcctggccgatttcaccgcaggccttgaccagccggtgcagaccgcggtg
gtggccatcgccggactgctcgatggcgatgtgctgatcaattccaacctgccgtggacg
gtcttgctgtcgaccacccgcgcgcagtccgggctgcacgagttgcagctgatcaacgat
ttcgaggcggtggcgctggccatcccttatctgcagccggacacgctggtgccgctgaac
ggcgatgctgatccggcgcaggcattcccggcgctggtgctgggtgccggtaccggcctg
ggcgccgcactgcgctttgccgacggcgagcgcccggtgctggccagcgagatcggccat
gccgcgcttggcgccggcaacgcgctggaactgcaggtgctgggcaagctgctgcagcgt
tgggcgcacgtggacaacgaacgcgtgctgtccggcagcggcctgatgaacctgtatccg
tgcctgtgcgaactgcgcggcgtcaccccggtgtggaccagcaccgaggcactgatcggc
gccgcacgcagcggcgaggatgcgctggccgtggaaacgctgcaggtgttctgcgcgtgg
ctgggcagcctggccggcgacgcagcgatcgccgtcggtgcgcgctcggtgtacctcgcc
gggggcatttccgcgcatgtgcaggatttcctggccgatggccgcttccgtgagcgcttc
ctcaacaagggcgtgctgaccgaggtgctgcgccaggtgccggtatggcgcgtggagcac
ggccagttgggcgtgctcggcgcagcggtctggcacgccgcacggcagcccacgcacgac
tga

DBGET integrated database retrieval system