KEGG   Stenotrophomonas maltophilia K279a: Smlt2374Help
Entry
Smlt2374          CDS       T00718                                 

Definition
fatty acid desaturase (membrane)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sml01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sml01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2416045..2416995)
Genome map
AA seq 316 aa AA seqDB search
MASVAPLPRRRWRLLRTLQRWVDTSNATETTGEQPGRIDWVRAVPFALMHLACIAVIWVG
VSWTAVVVATALYAVRMFAITAFYHRYFSHRTFQASRPVQFVFAVIGASSVQRGPLWWAA
HHRHHHRHADQPLDPHSPREGGFWRSHMGWFLTREAFATDLSRVPDLARFPELRWLDRFD
TAIPVLLAIGLYALGAALERWAPGLHTTGPQLLVWGFFISTIVLFHATVTINSLAHRFGR
RRFETRDDSRNNLWLALLTFGEGWHNNHHFFPGTVRQGFRWWEVDLTWYGLRAMAALGLV
KGLKPIPEWVLAKARY
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgtagcgcccctcccccgtcgacgctggcgcctgctgcgtacgttgcagcgg
tgggtggataccagcaacgccacagagaccaccggcgaacagccaggacgcatcgactgg
gtgcgcgcggtaccctttgcactgatgcacctggcctgcatcgcggtgatctgggtgggc
gtgtcatggacggcggtcgtcgtggccacggcgctctacgccgtgcgcatgttcgccatc
acggcgttctatcaccgctacttctcgcaccgcaccttccaggcatcgcgtccggtgcag
ttcgtgttcgcggtcatcggcgcgtccagcgtgcagcgcggtccgctgtggtgggccgcc
catcatcgccaccaccatcggcatgccgaccagccgctggacccgcattcgccgcgcgaa
ggcggcttctggcgcagccacatgggctggttcctcacccgcgaggcattcgccaccgat
ctgtcgcgggtacctgacctggcgcgcttccccgagctgcgctggctcgaccgtttcgat
accgccattcccgtgctgctggccatcggactgtatgcattgggtgcagcactggaacgc
tgggcacccggcctgcacaccacgggcccgcagttgctggtgtggggcttcttcatctcc
accatcgtgctgttccatgccaccgtcaccatcaattcgctggcccaccgtttcggccgc
cgccgcttcgagacccgcgacgacagccgcaacaacctgtggctggcgctgctcaccttc
ggtgagggctggcacaacaaccatcactttttccccggcaccgtgcgccagggcttccgc
tggtgggaggtggacctgacctggtacggactgcgcgcgatggcggcgctgggcctggtc
aaagggctcaagcccatccccgagtgggttctggccaaggcgaggtactga

DBGET integrated database retrieval system