KEGG   Stenotrophomonas maltophilia K279a: Smlt2758Help
Entry
Smlt2758          CDS       T00718                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sml00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2790660..2792504)
Genome map
AA seq 614 aa AA seqDB search
MNTDAAVREAARRAGLLVRWTDVAGAEREVAPDVLRAVLSEFACDGAPVVHPLLTACCGQ
LLAMPEATGAACWVDEQGTALPARADAQGRWRVPDQPGYWQRRQGGQQQAVAVAPQRAWW
PQGLLRGWGLSAQVYSLRAPDDAGIGDSAGCARWRELLHRHGGDALALSPLHAGLPPGPG
YSPYSPSDRRWLDPLQVSLPQVLPEAASSVLREDEALAMAVEAATAARRIDWPHSSAVKW
RWLRQGRQWLRQQAPAQYEQLQTWCDAQGEPLLRYCEHAADRFTGSADDHAFAQWLARQG
WAQVQAGLRSDGASIGLIADLAVGCAPQGVEARTGGDRLLQSLELGAPPDAFNPLGQAWG
ITSWSPSALQREGFEPFIRVLRAVMAGRGGLRIDHILGLQRLWVLPRGAGAGQGVYLRYP
FDDLINLLVLESWRHRCVLIGEDLGVVPPGIRQRLAARGVLGLEVLPFARNGERFLPAPR
WRRDAVAMPSTHDLPPLAGWLRGRDLRWRARLGELTELPAALHARASEVQALSAVARGEG
ATLEARALSLVAHAPSRLALLPLEDALGSRAQVNLPGTVSGHPNWRRRLPLAWDPDAADA
RIARFSATRRKAGR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggatgcggcggtgcgggaggcggctcgccgtgcgggcctgctggtccgctgg
accgacgtggccggagcagagcgcgaggttgcgcccgacgtgctgcgcgccgtgctgtcg
gagttcgcgtgcgacggtgcgccggtggtccacccgttgctcaccgcctgctgtggtcag
ctcctggccatgcctgaggcaacgggcgcggcgtgctgggtggacgagcagggcacagcg
ttgcctgcacgtgcggatgcgcaagggcgctggcgggttccggatcagccaggctattgg
cagcggcgccagggcgggcagcaacaggcggttgcggtggcaccgcagcgtgcctggtgg
ccgcagggcctgctgcgcggttggggtctgtcggcgcaggtctacagcctgcgcgcgccc
gatgatgccggcatcggtgacagcgccggctgtgcgcggtggcgcgagctgctgcaccgt
cacggcggcgatgcactggcgttgagtccgctgcacgccggcctgccaccgggtccgggc
tacagtccttactcgcccagcgaccggcgctggcttgacccgctgcaggtgtcgctgccg
caggttttgccggaggccgccagcagcgtgttgcgcgaggacgaagcactggcgatggcc
gttgaagcggctaccgcagcacgccgcatcgactggccgcactcgtcggcagtgaagtgg
cgctggctgcgccaagggcgccaatggctgcggcagcaggcgccggcacagtacgaacag
ttgcagacgtggtgcgatgcgcagggcgaacccctgctgcggtattgcgagcacgccgct
gaccgcttcactggaagcgccgacgaccatgcgtttgcgcagtggttggcgcggcaaggc
tgggcgcaggtgcaggcgggactgcgcagcgacggcgcgtcgatcggactgatcgcggat
ctggcagtgggttgtgcaccgcagggcgtcgaggcccggaccggcggcgaccgtctgctg
cagagcctcgagctgggcgcgccgccggatgcgttcaatccgctgggccaggcctggggt
atcaccagctggtcaccctctgcgttgcagcgcgaagggtttgaaccgttcatccgcgtg
ttgcgcgccgtgatggcgggtcgcggtggattgcgcatcgaccacatcctgggcctgcag
cggctgtgggtgctgcctcgtggcgcaggcgccgggcagggggtgtacctgcgctatccg
ttcgatgatctgatcaacctgctggtgctggaatcgtggcgccatcgctgcgtgctgatt
ggcgaagacctgggcgtggttcctccgggtatccgccagcgactggcagcccgtggcgtg
ctggggctggaggtgctgccgttcgcccgcaacggtgagcgcttcctgccggcgccacgg
tggcgccgcgatgcggtggccatgccctccacccatgatctgccgccgctggccggctgg
ctgcgtgggcgcgacctgcgctggcgtgcacgcctgggtgagctgaccgagcttcccgcg
gcgctgcacgcgcgtgccagcgaggtacaggcgctgtccgcagtcgcccggggcgagggc
gcgacgctggaagcgcgtgcgctgtcactggtggcgcacgcaccttcacggctggcgctg
ctcccgctggaagatgcgctgggcagccgcgcgcaggtgaacctgccgggtaccgtcagt
ggtcacccgaactggcgccgacgcttgccgcttgcgtgggatccggacgcggccgatgcg
cgcattgcccggttcagcgccacgcgacgcaaggcgggacgatga

DBGET integrated database retrieval system