KEGG   Stenotrophomonas maltophilia K279a: Smlt2919Help
Entry
Smlt2919          CDS       T00718                                 

Gene name
cgb
Definition
beta-D-glucosidase (EC:3.2.1.21)
Orthology
K05349  
beta-glucosidase [EC:3.2.1.21]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Cyanoamino acid metabolism
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Smlt2919 (cgb)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Smlt2919 (cgb)
Enzymes [BR:sml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Smlt2919 (cgb)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2964190..2967198)
Genome map
AA seq 1002 aa AA seqDB search
MNALAQSSQDWVALRGPGRQVVTPGGGSRAQTGPSIGLRDVAWQPLRGMNAAPFGGTFPG
PIALATELRLPMKTFTKPLALSLALSAALAAPAWADPAAFTVLTLEQAPTAEAMPALAAQ
LKTLQVDAVSVRQVQRGIGQVDPLQVLADGLGYAYRFIAAGKDDGQTQRGQAVLTRLPIA
AESGPDQPGLNYLRLDDGRHTVAVYTDAGAGAAQLPALVTRSRLGAPAVLLGAVAGESAK
AAGFDPARVALEADASYFSDGFQAASSAPFKVEGSTLRATLLTLAYAADTHGDRPWMDTT
LNADARAALLLKAMTEDEKFQMLHSYFGLGKDGGPLPEGAVGSAGFVPGVARLGIPSQQS
ADAGVGVTNPGGIRPGDFATAMPSGPSTASSWNREVAFAGGATMGREAWQQRFNILLSGS
VNLQRDPRNGRNFEYAGEDPLLAGSMVGALIQGVQSQHVISSMKHFALNDMETRRNFHDV
RIGEQAMHESDLLAFEIALEAGRPGVAMCSYNKINGTYGCENGYLMNQVLKQEWKFPGFV
MSDWGGVHSGSKAALAGLDQQSAGEVFDAAVFFDEPLRLAVHGGVVPQARLNDMVARILR
TMFLHGSFDNPPQHQKVDAEAGFAVAQRTVEEGSVLLRNEGNLLPLADSVKRIVIIGGHA
DKGVIGGGGSSMVGVTAKGTNAVPGVMPTTWPGPVIFHPSSPLESLRAARPDATIEYVDG
INAAAAAKAAAQADVAIVFATQWAAESVDLPDMQLPDNQDALISAVAKANPKTVLVLETN
GPVRTPWLAQVPAMLQAWYPGIRGGEGIAALLTGQVNPSGRLPVTWVTDESQLPRPHIDG
LGFKPAKPFGDVFDFDIEGANVGYKWMAAKGLTPTFSFGHGLSYTSFAYENLKVSVEGSR
LVASVDIRNTGKRAGADVAQLYLKLPAGSTTPIRLIGYDKVNLQPGEQRRIRIEAEPKTL
AHYDAQARQWKIDSGTYQVQLSRNAAEPLQSVDVQLVEQVLR
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgccctcgcacaatcttcacaggattgggtcgccctgcgcggcccgggcaggcag
gttgtcacgccgggaggagggtcccgcgcgcagaccggcccgtccatcggcctgcgggac
gttgcctggcaacccctgcgcggcatgaacgctgcacccttcggcggcactttccctgga
ccgattgccttggcaacggaattacgcctgccgatgaaaacgtttacaaagccgcttgca
ctgtccctggccctgtctgccgcactggccgccccggcctgggccgaccccgccgcgttc
actgtgctgaccctggaacaggccccgaccgccgaggcgatgccggccctggccgcccag
ctgaagaccctgcaggtggacgcggtgagcgtgcgccaggtgcagcgcggcatcggccag
gtcgatccgctgcaggtgctggccgatggcctgggctacgcgtaccgcttcattgctgcc
ggcaaggatgatggccagacccagcgcggccaggccgtgctgacccggttgccgatcgcc
gctgaatccggccccgaccagccgggcctgaactacctgcgcctggacgacggccgccac
accgtggcggtctataccgatgccggtgcaggtgcggcgcagctgccagcgctggtcacc
cgttcgcggctgggtgcaccggcggtgctgctcggcgcggtggccggtgaatcggccaag
gccgcaggcttcgatccggcgcgtgtcgcgctggaagccgatgccagctatttcagcgat
ggcttccaggccgccagcagtgcgccgttcaaggtggaaggcagtaccctgcgcgccacc
ctgctgaccctggcctacgccgccgacacgcatggcgacaggccgtggatggacaccacc
ctcaacgccgacgcgcgcgctgcgctgctgctgaaggcgatgaccgaggatgagaagttc
cagatgctgcacagctacttcgggctgggcaaggacggtggcccgctgccggaaggcgca
gtcggttcggccggtttcgtgccgggcgtggcgcggctgggcattccgtcgcagcaatcg
gccgatgccggcgtcggcgtgaccaatccgggtggcatccgcccgggcgatttcgccacg
gcgatgccgtcgggcccgtccaccgcatcgagctggaaccgtgaagtcgccttcgccggt
ggcgccacgatgggtcgcgaggcatggcagcagcgcttcaatatcctgctgtcgggcagc
gtcaacctgcagcgcgacccgcgcaacggccgcaacttcgaatatgccggtgaagatccg
ctgctggccggctcgatggttggcgcgctgatccagggcgtgcagagccagcacgtgatc
tcctcgatgaagcacttcgcgctgaacgacatggagacccgccgcaacttccacgacgtg
cgcatcggcgaacaggccatgcacgagtcggacctgctggccttcgagatcgcgctggaa
gccggtcgcccgggcgtggcgatgtgctcgtacaacaagatcaacggcacctacggctgc
gagaacggctacctgatgaaccaggtgctgaagcaggaatggaagttccccggtttcgtg
atgtccgactggggtggcgtgcacagtggctcgaaggcggcgctggccggcctcgatcag
cagtcggccggtgaagtgttcgacgcggcggtgttcttcgacgaaccgctgcgcctggcc
gtgcacggtggcgtggtgccgcaggcgcgcctgaacgacatggtggcgcgcatcctgcgc
acgatgttcctgcatggcagcttcgacaacccgccgcagcaccagaaggtcgatgccgag
gccggcttcgccgttgcccagcgcacggtggaagagggcagcgtgctgctgcgcaatgag
ggcaacctgctgccgctggccgacagcgtgaagcgcatcgtcatcatcggtggccatgcc
gacaagggcgtgatcggtggcggtggttcgtcgatggtgggcgtgaccgcaaagggcacc
aatgcggtgccgggcgtgatgccgaccacctggccgggcccggtgatcttccacccgtcc
tcgccgctggaatcgctgcgtgcggcgcgcccggacgcgaccatcgagtatgtggacggg
atcaatgccgccgctgcggccaaggccgccgcgcaggctgacgtggccatcgtgttcgcc
acccagtgggccgccgaatcggtggacctgccggacatgcagctgccggacaaccaggat
gccctgatctcggcagtggccaaggccaacccgaagaccgtgctggtgctggaaaccaac
ggcccggtgcgcacgccgtggctggcgcaggtgccggcgatgctgcaggcctggtatccg
ggcatccgcggtggcgaaggcattgccgcgctgctgaccggccaggtcaatccgtccggc
cgcctgccggtgacctgggtgacggacgaatcgcagctgccacgcccgcacatcgacggc
ctcggcttcaagccggccaagccgtttggtgatgtgttcgatttcgatatcgaaggcgcc
aacgtcggctacaagtggatggcggccaagggtctgaccccgaccttctcctttggccat
ggcctgtcctacacctcattcgcctatgagaacctgaaggtgagcgtggagggctcgcgc
ctggtcgccagcgtcgacatccgcaacaccggcaagcgtgccggtgccgacgtggcccag
ctgtacctgaagcttccggccggcagcaccacgccgatccgcctgatcggctatgacaag
gtgaacctgcagccgggcgaacagcgccgcatccgcatcgaagccgagccgaagaccctg
gcccactacgatgcacaggcgcgccagtggaagatcgacagcggcacctaccaggtgcag
ctgtcccgcaatgcggccgagccgctgcagagcgtggacgtgcagctggtggagcaggtg
ctgcgctga

DBGET integrated database retrieval system