KEGG   Stenotrophomonas maltophilia K279a: Smlt3183Help
Entry
Smlt3183          CDS       T00718                                 

Definition
vitamin B12 transport protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sml00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sml00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3226802..3227389)
Genome map
AA seq 195 aa AA seqDB search
MPLPTVMPRRLRGLSLLTLLVAGLAGSTQVLAADLLDLDYRPLASKQQVNLQQRYHGQVL
LVVNTASKCGYTPQYEGLEALQKRYAGRGFAVLGFPSNDFKGQEPGDEKQIQDFCTLTYG
VKFPMFEKVHVVGAEATPLYQRLTAATGVAPGWNFHKYLVGRDGKVIAQFASKVTPDDPQ
LTAAIDKALAAAAAH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgccgaccgttatgccgcgccgcctgcgcggcctgtccctgctgaccctgctg
gtagccggcctggccggttccacccaggtgctggcggccgatcttctcgacctcgactac
cgcccgctggccagcaagcagcaggtcaacctgcagcagcgctaccacgggcaggtgctg
ctggtggtcaataccgcaagcaagtgcggctatacccctcagtacgaaggcctggaggcg
ctgcagaagcgctatgccggccgaggttttgccgtgctcggcttcccgtccaacgatttc
aagggccaggagcccggtgacgagaagcagatccaggatttctgcacgctcacctacggg
gtcaagttcccgatgttcgagaaggtgcacgtggtcggtgcggaggcgacgccgctctat
caacggttgaccgcggccaccggggtggcaccgggctggaatttccacaagtacctggtc
ggccgcgatggcaaggtcatcgcccagttcgccagcaaggtgacgccggatgatccgcag
ctgactgcggccatcgacaaggcgctggccgcagcggccgcacattga

DBGET integrated database retrieval system