KEGG   Stenotrophomonas maltophilia K279a: Smlt3198Help
Entry
Smlt3198          CDS       T00718                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:sml01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sml00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sml00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3241531..3242733
Genome map
AA seq 400 aa AA seqDB search
MATEVKAPVLPESVADGTIATWHKKVGDAVKRDENLLDLETDKVVLEVPSPVDGVLKEIK
FAEGSTVTSSQVVAIIEEGAVAAAPAPAAEAAPAAAAAPAAAAPAAAAAPAPAAKSAADA
LPPGARFTAITEGVNPADVDGTGRRGAVTKEDIVNFARNGGAGKAGGARPEERVPMTRIR
KRIAERLMESKNSTAMLTTFNEVDLSKVSAARKELQDEFVKAHGIKLGFMSFFVKAAANA
LQRFPLVNASIDGDDIIYHGYSDISIAVSTEKGLVTPVLRNVERMSFADIEKTIADYAKK
ARDGKLGLDELQGGTFTVTNGGTFGSLLSTPIINPPQSAILGMHAIKERPIAQNGQVVIA
PMMYLALSYDHRIIDGKDSVQFLVDIKNQLENPGRMLFGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaagtcaaagccccggtactgcccgaatccgtcgccgacggcaccatcgcc
acctggcacaagaaggtgggcgacgccgtcaagcgcgacgaaaacctgcttgacctggaa
accgacaaggtcgtcctggaagtgccgtcgccggtcgacggcgtgctgaaggaaatcaag
ttcgccgaaggctcgaccgtgacctccagccaggtcgtggcgatcatcgaagaaggcgcc
gtggctgctgccccggctccggctgccgaagccgctccggctgcagccgctgccccggcc
gctgctgctccggccgctgccgccgctccggccccggccgccaagtcggccgccgatgcg
ctgccgccgggcgcccgcttcaccgccatcaccgaaggcgtgaacccggccgacgtcgac
ggcaccggccgtcgcggcgcggtgaccaaggaagacatcgtcaacttcgcccgcaacggc
ggcgccggcaaggccggtggcgcacgtccggaagaacgcgtgccgatgacccgcatccgc
aagcgcatcgccgagcgcctgatggagtcgaagaactccaccgcgatgctgaccaccttc
aacgaagtcgacctgtccaaggtctcggcggcgcgcaaggaactgcaggacgagttcgtc
aaggcacacggcatcaagctgggcttcatgagcttcttcgtgaaggccgccgccaacgcg
ctgcagcgcttcccgctggtcaacgcctcgatcgacggcgacgacatcatctaccacggc
tactcggacatctcgatcgccgtctcgaccgaaaagggcctggtcaccccggtcctgcgc
aatgtcgagcgcatgtcgttcgccgacatcgagaagaccatcgccgactacgccaagaag
gcgcgtgacggcaagctgggcctggatgaactgcagggcggtaccttcaccgtgaccaac
ggcggcaccttcggttcgctgctgtcgaccccgatcatcaacccgccgcagagcgccatc
ctgggcatgcacgccatcaaggagcgtccgatcgcccagaacggccaggtcgtgatcgcg
ccgatgatgtacctggcgctgtcgtacgaccaccgcatcatcgacggcaaggattcggtg
cagttcctggtggacatcaagaaccagctggaaaacccgggccgcatgctgttcggcctg
taa

DBGET integrated database retrieval system