KEGG   Stenotrophomonas maltophilia K279a: Smlt3218Help
Entry
Smlt3218          CDS       T00718                                 

Definition
phospholipase
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Smlt3218
   00565 Ether lipid metabolism
    Smlt3218
   00590 Arachidonic acid metabolism
    Smlt3218
   00591 Linoleic acid metabolism
    Smlt3218
   00592 alpha-Linolenic acid metabolism
    Smlt3218
Enzymes [BR:sml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Smlt3218
    3.1.1.32  phospholipase A1
     Smlt3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3262308..3263462
Genome map
AA seq 384 aa AA seqDB search
MTLSPLLPRLAPLALALASAPLAAQEFAPSAEASPAACAAITTDAARLACYDRQFGRTPQ
ATAEADAAAEAAAQARREERQTARVSQGEEKLRERVSDLFRPAAPDSALANAGRGSLLDS
RWELAEDSKLGPFQLRAYKPVYLLPAFWTSDRNTTPHSPNPANTVTTPQVLDSAELKFQI
SFKTKIAENLFGDNGDIWAGYTQSSRWQAYNGEDSRPFRETNYEPEVMMVFRNGYSIGGW
RGRMTGIALNHQSNGRADPLSRSWNRVMLNIGLDRENWALVLRPWYRIPETRSDDNNPDI
EDYMGRGDATLTWNRNGHEVSLMARHSLRTGSRSHGALQLDYGFPISNLLRGHVQVFDGY
GESLIDYNHKATYVGVGVSLLEWF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtctccgctgcttccccgtctcgcgccgctggcgctggccctggccagtgcg
ccgctggccgcgcaggagttcgcgcccagcgccgaagcctcgccggccgcgtgcgcggcg
attaccaccgatgctgcccgcctggcctgttatgaccgccagttcggccgtaccccgcag
gccactgccgaggccgacgctgcggccgaggcggccgcgcaggcccgtcgcgaagaacgt
cagactgcacgcgtgagccagggcgaagagaagctgcgcgagcgggtcagcgatctgttc
cgtccagcagcccctgacagcgcactggccaatgctggccgcggttcgctgctggacagc
cgctgggaactggccgaggactccaagctgggcccgttccagctgcgcgcctacaagccg
gtgtacctgctgccggcgttctggaccagcgatcgcaacaccacgccgcattcgccgaac
ccggccaacacggtcaccacgccgcaggtgctggacagtgccgagctgaagttccagatc
agtttcaagaccaagatcgccgagaacctgttcggcgacaacggcgacatctgggccggc
tacacccagagctcgcgctggcaggcctacaacggcgaggattcacgcccgttccgcgaa
accaattacgagccggaagtgatgatggtgttccgcaacggctactcgatcggtggctgg
cgcgggcgcatgaccggcatcgcgctgaaccaccaatccaacggccgcgccgacccgctt
tcgcgcagctggaaccgggtgatgctcaacatcggcctggaccgcgagaactgggcgctg
gtgctgcgcccctggtaccgcattcccgagacccgcagcgacgacaacaacccggacatc
gaggattacatgggccgcggtgatgcgaccctgacctggaaccgcaacggccacgaagtc
tcgctgatggcgcgccattcgctgcgcaccggcagccgctcgcacggtgccctgcagctg
gattacggcttcccgatcagcaacctgctgcgcgggcatgtgcaggtgttcgacggttac
ggcgaaagcctgatcgactacaaccacaaggccacctacgtgggcgtgggcgtgtcgctg
ctggagtggttctga

DBGET integrated database retrieval system