KEGG   Stenotrophomonas maltophilia K279a: Smlt3228Help
Entry
Smlt3228          CDS       T00718                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Smlt3228
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Smlt3228
Enzymes [BR:sml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Smlt3228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3271248..3271727)
Genome map
AA seq 159 aa AA seqDB search
MTTAYDFSFRDLDGQPQALAGYRGHPLLLVNVASRCGFTPQYTGLEQLWQEYRERGLVVI
GFPCNQFGAQEPGDAAQIRQFCSLDYPVSFPLSEKIEVNGEGADPLWAWLSREKRGLLGS
ARIKWNFSKFLVDRQGRVAARFAPTTRPEQLRSAIEALL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgcctacgatttcagcttccgcgacctcgacggccagccacaggccctcgcc
gggtaccggggtcacccgctgttgctggtcaatgtcgccagccgctgtggcttcaccccg
cagtacaccgggctggaacagctgtggcaggagtatcgcgagcgtggcctggtggtgatc
ggcttcccatgcaaccagttcggcgcgcaggagccgggggacgccgcgcagatccgccag
ttctgttcgctggattatccggtcagcttcccgctttcggagaagatcgaggtcaacggc
gagggggctgatccgttgtgggcatggctgtcacgcgagaagcgcggcctgctgggtagc
gcccgcatcaagtggaatttcagcaagttcctggtcgatcgccaggggcgggtggctgcg
cgctttgcgccaaccaccaggccggaacagctgcgcagcgcgatcgaagcgctgctgtga

DBGET integrated database retrieval system