KEGG   Stenotrophomonas maltophilia K279a: Smlt3294Help
Entry
Smlt3294          CDS       T00718                                 

Gene name
proB
Definition
(GenBank) putative glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00330  Arginine and proline metabolism
sml00332  Carbapenem biosynthesis
sml01100  Metabolic pathways
sml01130  Biosynthesis of antibiotics
sml01230  Biosynthesis of amino acids
Module
sml_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Smlt3294 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Smlt3294 (proB)
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Smlt3294 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CAQ46729
UniProt: B2FMD4
Position
complement(3339397..3340485)
Genome map
AA seq 362 aa AA seqDB search
MLKVGSSLLAADGGGLSPRHALGLAQFVSANVLAGREVVIVSSGAVAAGRAILPRADEPG
AAMAARQALAALGQAQLIGLWQRFFERPVAQVLLTHDDLRNRRRYLNARATLNELLRLGA
LPVVNENDTVSVDELKLGDNDNLAATVAALVDADALFIATDIDGLYSADPRTVADARPLH
DVPELSDEVLAMAGGAGSRAGTGGMRTKLEAAAKAGRLGIETYLFNGRSGDVVRALAQDR
LFGTRIHAARSREAARKHWLRHAPLVEGAIVIDAGAAQAMREKGASLLPGGITGAEGMFR
RGDMVQVCWNAPQGRVCVARGVSQYAADDVRRIAGRHSRDIEAVLGYNYGGSVVHRDDLV
LP
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaaggtcggcagcagcctgctggcagccgatggcggcggcctgtcaccacgccac
gcgctgggcctggcgcagttcgtctcggccaatgtcctggccgggcgcgaggtggtgatc
gtgtcttccggcgcggtcgctgccgggcgcgcgatcctgccgcgggccgatgaacctggc
gcggcgatggcggcgcggcaggcgctggctgcgctcggccaggcccagctgatcgggctc
tggcagcgcttcttcgagcgcccggtggcgcaggtgctgctgacccatgacgacctgcgc
aaccgccgccgctacctcaacgcccgcgccacgctcaacgaactgctgcggctgggcgcg
ttgccggtggtcaacgagaacgacaccgtgtcggtggacgagctcaagcttggcgacaac
gacaacctggcggcgacggtggcggcgctggtcgatgccgatgcgctgttcatcgccacc
gatatcgatggcctgtacagcgccgacccgcgcaccgtggccgacgcgcggccgctgcac
gacgtgccggaactgagtgacgaggtgctggcgatggccggcggcgccggctcgcgcgcc
ggtaccggcggcatgcggaccaagctggaagcggcagcgaaggcgggtcgtctcggcatc
gaaacctatctgttcaatggccgtagcggtgacgtggtacgcgcgctggcccaggaccgc
ctgttcggtacccgtatccacgccgcgcgcagccgtgaggcggcccgcaagcactggctg
cggcacgcgccgctggtcgagggagcgatcgtgatcgatgccggcgcggcgcaggcgatg
cgcgagaagggcgcctcgctgctgcccggcggcatcaccggcgcggagggcatgttccgc
cgtggcgacatggtgcaggtgtgctggaacgcgccacagggccgcgtctgcgtggcgcgc
ggcgtcagccagtacgcggccgatgatgtgcgccggatcgccggccgccattcgcgcgac
atcgaggccgtgctgggctacaactacggtggcagtgtcgtccatcgcgacgatctggtg
ctgccatga

DBGET integrated database retrieval system