KEGG   Stenotrophomonas maltophilia K279a: Smlt3407Help
Entry
Smlt3407          CDS       T00718                                 

Gene name
tpiA
Definition
(GenBank) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00010  Glycolysis / Gluconeogenesis
sml00051  Fructose and mannose metabolism
sml00562  Inositol phosphate metabolism
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01120  Microbial metabolism in diverse environments
sml01130  Biosynthesis of antibiotics
sml01200  Carbon metabolism
sml01230  Biosynthesis of amino acids
Module
sml_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smlt3407 (tpiA)
   00051 Fructose and mannose metabolism
    Smlt3407 (tpiA)
   00562 Inositol phosphate metabolism
    Smlt3407 (tpiA)
Enzymes [BR:sml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Smlt3407 (tpiA)
Exosome [BR:sml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Smlt3407 (tpiA)
  Exosomal proteins of bladder cancer cells
   Smlt3407 (tpiA)
  Exosomal proteins of melanoma cells
   Smlt3407 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAQ46835
UniProt: B2FNY1
Position
complement(3448299..3449054)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGSRQFANELLGQVAAGLPLEGVDVVILPPLPYLGELVEDFGETGLAF
GAQDVSSNEKGAYTGEVCAAMLVEVGARYGLVGHSERRQYHHESSELVARKFAAAQHAGL
VPVLCVGETLEQREAGQTEAVIASQLAPVLELVGAAGFAQAVVAYEPVWAIGTGRTATKE
QAQQVHAFIRGEVARIDARIADSLPIVYGGSVKPDNAGELFAQPDVDGGLVGGASLVAAD
FLAIARAAAAN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcaagatcgtcgccggaaactggaagctgcatggcagccgtcaattcgccaat
gaactgctggggcaggtggctgccgggctgccgctggagggggtggacgtggtgatcctg
ccgccgctgccgtacctgggcgagctggtcgaggacttcggcgagaccggcctggccttt
ggcgcgcaggacgtgagcagcaacgagaagggcgcctacaccggcgaggtctgcgcggcc
atgctggtcgaggtcggggcccgctatggcctggtcggccattccgagcgccgccagtac
caccacgagagcagcgagctggtcgcgcgcaagttcgccgccgcccagcacgccggcctg
gtgccggtgctgtgcgtgggcgagaccctggaacagcgcgaggccgggcagaccgaagcg
gtcatcgccagccagctggcaccggtgctggagctggttggcgcggccggtttcgcccag
gctgtggtcgcctatgagccggtctgggccatcggtaccggccgtaccgccaccaaggag
caggcacagcaggtgcacgcgttcatccgtggcgaagtcgcgcgtatcgatgctagaatc
gctgattcactgcccattgtttacggcggtagcgtgaagcccgacaatgccggggaactg
ttcgcgcagccggatgtcgatggtgggctggtcggcggcgcctccctggtggctgcggac
ttcctggccatcgcaagggcggcggccgcgaactaa

DBGET integrated database retrieval system