KEGG   Stenotrophomonas maltophilia K279a: Smlt3407Help
Entry
Smlt3407          CDS       T00718                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smlt3407 (tpiA)
   01230 Biosynthesis of amino acids
    Smlt3407 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smlt3407 (tpiA)
   00051 Fructose and mannose metabolism
    Smlt3407 (tpiA)
   00562 Inositol phosphate metabolism
    Smlt3407 (tpiA)
Enzymes [BR:sml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Smlt3407 (tpiA)
Exosome [BR:sml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Smlt3407 (tpiA)
  Exosomal proteins of bladder cancer cells
   Smlt3407 (tpiA)
  Exosomal proteins of melanoma cells
   Smlt3407 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3448299..3449054)
Genome map
AA seq 251 aa AA seqDB search
MRRKIVAGNWKLHGSRQFANELLGQVAAGLPLEGVDVVILPPLPYLGELVEDFGETGLAF
GAQDVSSNEKGAYTGEVCAAMLVEVGARYGLVGHSERRQYHHESSELVARKFAAAQHAGL
VPVLCVGETLEQREAGQTEAVIASQLAPVLELVGAAGFAQAVVAYEPVWAIGTGRTATKE
QAQQVHAFIRGEVARIDARIADSLPIVYGGSVKPDNAGELFAQPDVDGGLVGGASLVAAD
FLAIARAAAAN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcaagatcgtcgccggaaactggaagctgcatggcagccgtcaattcgccaat
gaactgctggggcaggtggctgccgggctgccgctggagggggtggacgtggtgatcctg
ccgccgctgccgtacctgggcgagctggtcgaggacttcggcgagaccggcctggccttt
ggcgcgcaggacgtgagcagcaacgagaagggcgcctacaccggcgaggtctgcgcggcc
atgctggtcgaggtcggggcccgctatggcctggtcggccattccgagcgccgccagtac
caccacgagagcagcgagctggtcgcgcgcaagttcgccgccgcccagcacgccggcctg
gtgccggtgctgtgcgtgggcgagaccctggaacagcgcgaggccgggcagaccgaagcg
gtcatcgccagccagctggcaccggtgctggagctggttggcgcggccggtttcgcccag
gctgtggtcgcctatgagccggtctgggccatcggtaccggccgtaccgccaccaaggag
caggcacagcaggtgcacgcgttcatccgtggcgaagtcgcgcgtatcgatgctagaatc
gctgattcactgcccattgtttacggcggtagcgtgaagcccgacaatgccggggaactg
ttcgcgcagccggatgtcgatggtgggctggtcggcggcgcctccctggtggctgcggac
ttcctggccatcgcaagggcggcggccgcgaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system