KEGG   Stenotrophomonas maltophilia K279a: Smlt3417Help
Entry
Smlt3417          CDS       T00718                                 

Gene name
trpA
Definition
(GenBank) putative tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smlt3417 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smlt3417 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smlt3417 (trpA)
Enzymes [BR:sml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Smlt3417 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3458660..3459469)
Genome map
AA seq 269 aa AA seqDB search
MPVSRLDACFQRLREQQRKALIPFITAGDPSLEATVPVMHALVEAGADVIELGVPFSDPM
ADGPTIQRSSERALARGAGSRYVLQAVAQFRERDAQTPVVLMGYLNPVEIHGYAAFAKAA
VDAGVDGVLLVDLPPEEAVEAQQAFDAAGLALVLLASPTTSEARADKLLALARGYLYYVS
FAGVTGASERLDSDAASARLQALRARASVPVVAGFGIKDAASAAAMARQADGVVVGSALV
AVLAEAGSAEEAAQRAGDFLAPLRQALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtatcccgactcgatgcctgtttccagcgcctgcgcgagcagcagcgcaaggcg
ctgattcccttcatcactgccggtgatccctcgctggaggccaccgtgccggtcatgcac
gcgctggttgaggccggtgccgatgtgatcgagctgggcgtgccgttctccgacccgatg
gccgatggcccgaccatccagcgcagctccgagcgcgcgctggcacggggggctggcagc
cgctacgtcctgcaggccgtggcgcagttccgcgagcgcgacgcgcagaccccggtggtg
ctgatgggctacctcaacccggtggagatccatggctacgcggccttcgccaaggccgcc
gtcgacgcaggcgtggacggcgtactgctggtcgacctgccgccggaagaagcggttgaa
gcgcagcaggccttcgatgcagccggcctggcactggtcctgctggcgtcgccgaccacc
agcgaagcgcgggccgacaagctgctggcgctggcccgtggctacctctactacgtcagc
tttgccggtgtcaccggcgcgtccgaacgcctggacagcgatgccgccagtgcccgcctg
caggccctgcgcgcgcgcgcttcagtgccggtggttgctggcttcggcatcaaggacgcc
gccagtgcggcggcgatggcgcgccaggccgatggcgtggtggtcggcagtgcattggtg
gcggtgctggccgaagcgggctcggctgaagaggccgcgcagcgtgctggagacttcctg
gccccgctgcggcaggcgctggacgcgtaa

DBGET integrated database retrieval system