KEGG   Stenotrophomonas maltophilia K279a: Smlt3419Help
Entry
Smlt3419          CDS       T00718                                 

Gene name
trpB
Definition
(GenBank) putative tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Smlt3419 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Smlt3419 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Smlt3419 (trpB)
Enzymes [BR:sml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Smlt3419 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3460148..3461365)
Genome map
AA seq 405 aa AA seqDB search
MSASPIADYHAFPDAQGHFGRYGGSFVAETLVGPLQELAQAYDQARQDPAFQLAYDRDLA
HYVGRPSPIYHAQRLSDHVGGAQILLKREDLNHTGAHKINNTIGQALLAARMGKKRIIAE
TGAGQHGVASATVAARLGLECVVYMGATDIERQKINVYRMKLLGATVVPVTSGSATLKDA
LNEAMRDWVTNVQDTFYIIGTVAGPDPYPRMVRDFNAIVGREAREQMLAEYGRLPDAITA
CVGGGSNAIGLFHAFLNDRQVEIVGAEAAGDGINTGRHAASIAAGRPGVLHGNRTYVLCD
DDGQIIETHSVSAGLDYPGVGPEHAFLADTGRARYLGITDEEALQAFHLLAHTEGILPAL
ESSHALAQAIKLARERPRDQIVLCNLSGRGDKDVHTIAAREGLVL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctcccccattgccgactatcacgccttcccggatgcccagggccacttcggc
cgctatggcggcagtttcgttgccgaaaccctggtcggtccgctgcaggaactggcccaa
gcctatgaccaggcgcgccaggatcccgcattccagctggcctatgaccgcgatctggcg
cactacgtgggccggccgagtccgatttatcacgcccagcgcctgagcgatcacgtcggt
ggcgcgcagatcctgctcaagcgcgaggacctgaaccacaccggcgcgcacaagatcaac
aacaccatcggccaggccttgctggccgcgcggatgggcaagaagcgcatcattgccgag
accggggccggccagcatggcgtggccagtgccacggttgccgcgcggctgggcctggaa
tgcgtggtgtacatgggcgccaccgacatcgagcggcagaagatcaatgtttaccgcatg
aagctgctgggcgcgacggtggtgccggtcacttccggctcggccaccctgaaggacgca
ctcaacgaagccatgcgcgactgggtgaccaacgtgcaggacaccttctacatcatcggt
acggtcgccggtccggatccgtatccgcgcatggtccgtgacttcaatgccatcgtcggc
cgtgaggcgcgcgagcagatgctggccgagtacggccgcctgcccgatgcgatcaccgcc
tgcgtgggcggcggcagcaatgcgatcggcctgttccatgccttcctcaacgatcgccag
gtcgaaatcgtcggtgccgaagccgccggtgacggcatcaacaccggccgtcacgccgct
tcgatcgctgccggtcgccccggtgtgctgcacggcaaccgcacctatgtgctgtgcgac
gacgacggccagatcatcgagacccactcggtatcagccggcctggactatccgggcgtc
ggcccggagcacgcgttcctggccgataccggtcgcgcacgctacctcggcatcaccgac
gaggaagcgctgcaggctttccatctgctggcgcataccgaaggcatcctgccggcactg
gagtccagccatgcgctggcgcaggcgatcaagctggcgcgtgagcgaccgcgtgaccag
atcgtgctctgcaatctatccggccgtggcgacaaggacgtgcacaccatcgctgcgcgc
gaagggctggtgctgtga

DBGET integrated database retrieval system