KEGG   Stenotrophomonas maltophilia K279a: Smlt3556Help
Entry
Smlt3556          CDS       T00718                                 

Definition
(GenBank) putative enoyl-CoA hydratasee
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00071  Fatty acid degradation
sml00280  Valine, leucine and isoleucine degradation
sml00281  Geraniol degradation
sml00310  Lysine degradation
sml00362  Benzoate degradation
sml00380  Tryptophan metabolism
sml00410  beta-Alanine metabolism
sml00640  Propanoate metabolism
sml00650  Butanoate metabolism
sml00903  Limonene and pinene degradation
sml00930  Caprolactam degradation
sml01040  Biosynthesis of unsaturated fatty acids
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01120  Microbial metabolism in diverse environments
sml01130  Biosynthesis of antibiotics
sml01200  Carbon metabolism
sml01212  Fatty acid metabolism
Module
sml_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Smlt3556
   00650 Butanoate metabolism
    Smlt3556
  Lipid metabolism
   00071 Fatty acid degradation
    Smlt3556
   01040 Biosynthesis of unsaturated fatty acids
    Smlt3556
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Smlt3556
   00310 Lysine degradation
    Smlt3556
   00380 Tryptophan metabolism
    Smlt3556
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Smlt3556
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Smlt3556
   00281 Geraniol degradation
    Smlt3556
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Smlt3556
   00930 Caprolactam degradation
    Smlt3556
Enzymes [BR:sml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Smlt3556
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Smlt3556
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Smlt3556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH Pyr_redox_2 NAD_binding_2 MORN ApbA UDPG_MGDP_dh_N AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CAQ46977
UniProt: B2FQC8
Position
3605856..3607919
Genome map
AA seq 687 aa AA seqDB search
MLSGFDGLRFSHWHPEIRDDGVVVLSLDRQDSSVNAMSQDVLLELGDLLERIALDPPKGV
VIQSLKKAGFIAGADLKEFQEFDRRGTVNDAIRRGQATYQKLAELPCPTVAAIHGHCLGG
GTELALACRYRVASNDSSTRIGLPETQLGIFPGWGGSARLPQLVGAPAAMDMMLTGRTLS
ASAARGIGLVDKVVAPAVVLDTAVALALSGTTRPFKQRATAWATNTWLARTLLAPQMVKQ
VARKAKKDQYPAPYTLISTWQRSGGKPIQARLDAERRAVVKLASTPTARNLIRIFFLTER
LKGLGGGDSGIRHVHVVGAGVMGGDIAAWAAYKGFEVTLQDREQRFIDPAMERAQALFAK
KVRDESKRPAVAARLRADLEGNGVAEADLVIEAIIENPEAKRALYQTLEPKMKLDALLTT
NTSSIPLVELRDHIQRPAQFAGLHYFNPVAQMPLVEIIHHDGMAPETERRLAAFCKALGK
FPVPVAGSPGFLVNRVLFPYMLEAATAYAEGIPGPVIDRAAVKFGMPMGPIELIDTVGLD
VAAGVGRELAPFLGLQIPAALQTVEPDKRGKKDGQGIYTWENGKPKKPDVASDYQAPADL
EDRLILPLLNEAVACLHEGVVADADLLDAGVIFGTGFAPFRGGPIQHIRAVGADAIVERL
KALQQRHGDRFAPRPGWDNPTLREPVV
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgctctcaggcttcgatggtctccgcttcagccactggcaccccgagatccgcgacgac
ggcgtggtggtcctctccctggatcgccaggacagcagcgtcaatgccatgtcgcaggat
gtgctgctggagctgggtgacctgcttgagcgcattgcactggacccgcccaagggcgtg
gtgatccagtcgctgaagaaagccggcttcattgccggggcggacctgaaggagttccag
gagttcgaccgtcgtggcaccgtcaacgatgccatccgccgcggccaggctacctaccag
aagctggccgagctgccctgccccaccgtggcggccatccacggccattgcctgggcggc
ggcaccgagctggcgctggcctgccgctatcgcgtggcctccaatgacagcagcacccgc
atcggcctgccggaaacccagctgggcatcttcccgggctggggcggcagcgcgcgcctg
ccgcagctggtcggcgcacccgcggcaatggacatgatgctgaccggccgtacgctgtcg
gcctcggccgcgcgtggcatcgggctggtcgacaaggtggtggcaccggccgtggtgctc
gacaccgccgtggcgctggcgctgtccggcaccacgcgcccattcaagcagcgcgcaacg
gcctgggccaccaacacctggctggcacgcacgctgctggcaccgcagatggtcaagcag
gtcgcacgcaaggccaagaaggaccagtatccggcgccctacacgctgatcagcacctgg
cagcgcagtggcggcaagccgatccaggcgcgtttggacgccgagcgccgcgcggtggtg
aagctggccagcaccccgaccgcgcgcaacctgatccgcattttcttcctcaccgaacgc
ctgaagggcctcggtggtggtgattccggcatccgccacgtgcacgtggtcggcgccggc
gtgatgggcggtgacatcgccgcctgggccgcctacaagggctttgaagtgactctccag
gaccgcgagcagcgcttcatcgaccccgccatggagcgcgcgcaggcgctgttcgccaag
aaggtgcgcgacgagagtaagcgccccgccgtggccgcgcgcctgcgtgccgacctggaa
ggcaacggcgtggccgaggccgacctggtgatcgaagcgatcatcgagaacccggaagcc
aagcgtgcgctgtaccagacgctggaaccgaagatgaagctggacgcgctgctgaccacc
aacacctcgtcgattccgctggtggaactgcgcgaccacatccagcgcccggcgcagttc
gctggcctgcactacttcaacccggtggcgcagatgccactggtggagatcatccaccac
gacggcatggcgccggagaccgagcgccgcctcgccgcgttctgcaaggcgctgggcaag
ttcccggtaccggtggccggcagcccgggcttcctggtcaaccgcgtgctgttcccgtac
atgctggaagccgccaccgcatatgccgaaggcattccgggcccggtgatcgacagggcc
gcggtgaagttcggcatgccgatgggcccgatcgaactgatcgacaccgtcggcctggac
gtggccgccggcgtcggccgcgaactggcgccgttcctgggcctgcagattccagcggcc
ttgcagacggtggaaccggacaagcgcggcaagaaggacggccagggcatctatacctgg
gaaaacggcaagccgaagaagccggacgtggccagcgattaccaggccccggccgatctg
gaggaccgcctgatcctgccgctgttgaacgaggcggtggcgtgcctgcacgaaggcgtt
gtggccgatgcggacctgctggatgccggcgtgatcttcggtaccggctttgccccgttc
cgcggtggtccgatccagcacatccgtgcggtcggtgccgatgcgatcgtcgagcggctg
aaggcactgcagcagcgccacggcgaccgtttcgccccgcgcccgggctgggacaacccc
accctgcgcgaaccagtggtttga

DBGET integrated database retrieval system