KEGG   Stenotrophomonas maltophilia K279a: Smlt3664Help
Entry
Smlt3664          CDS       T00718                                 

Gene name
cysQ
Definition
inositol monophosphate protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Smlt3664 (cysQ)
Enzymes [BR:sml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Smlt3664 (cysQ)
Transfer RNA biogenesis [BR:sml03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Smlt3664 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3725784..3726587)
Genome map
AA seq 267 aa AA seqDB search
MIKLTTDLRETAIAIAQEAGQAIMQVYADGFEVQIKDDDSPVTAADLAANQVIELGLRQL
TPDLPILSEESAQVPWEHRRHWGAYWLVDPLDGTREFVKRNGEFSVNIALIYQGAPAFGV
VLAPVTGIVWHAMRGELAYRRQGLHDTVLRTRTPATAPLRVAASRSHRSPETEALLARMG
RIETIAQGSSLKFCRIAEGGLDVYPRLGPTSEWDTAAGQCVLHAAGGAVLSAATGKPFRY
NRRETLLNGDFIALGDTSLPWRDWLSD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactgaccacggacctgcgcgagaccgccatcgccatcgcccaggaagccgga
caggccatcatgcaggtgtacgccgatggcttcgaggtgcagatcaaggacgacgacagc
ccggtcaccgccgccgacctggccgccaaccaggtcatcgaactgggcctgcgccagctg
accccggacctgccgatcctgtcggaggaatcggcgcaggtgccttgggagcaccgccgc
cactggggcgcgtactggctggtggatccgctcgacggcacccgcgagttcgtcaagcgc
aatggcgagttcagcgtcaacatcgccctgatctaccagggcgcaccggctttcggcgtg
gtgctggcgccggtcaccggcatcgtctggcacgccatgcgtggcgagctggcctatcgc
cggcagggcctgcacgacaccgtgctgcgcacccgcacgccggccaccgccccgctgcgc
gtcgccgccagtcgctcgcaccgctcaccggaaaccgaggcgctgctggcgcgcatgggc
cgcatcgagaccatcgcgcagggctcttcgctgaaattctgccggatcgccgaaggtggc
ctggatgtctatccgcggctgggcccgacctccgaatgggataccgccgccggccagtgc
gtactgcacgccgccggcggtgcggtactgtcggccgcgaccggcaagccgttccgctac
aaccgccgcgaaaccctgttgaacggtgatttcattgcccttggtgataccagcctgcca
tggcgcgactggttgtccgactga

DBGET integrated database retrieval system