KEGG   Stenotrophomonas maltophilia K279a: Smlt3711Help
Entry
Smlt3711          CDS       T00718                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sml00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Smlt3711 (ruvA)
Enzymes [BR:sml01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Smlt3711 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3784504..3785097)
Genome map
AA seq 197 aa AA seqDB search
MIGRLRGIVAYKAPPWLVVDVNGVGYELEAPMSTFYDLPELGREVTLYTHYSQKEDSVSL
YGFLREGERRLFRDVQKVSGIGAKIALAVLSGVTVEEFARMVQAGDITALTRIPGIGKKT
AERMVLELRDRAAQFGAGGALPTGSGPAPADPLSDATVALQQLGYKPAEAARMARDAFNE
GDEVATVIRKALQSALR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgactgcgcggcatcgtcgcctacaaggcgccgccgtggctggtggtggac
gtgaacggagtgggctacgaactggaggcgccgatgagcaccttctacgacctgcccgag
ctcggccgcgaggtcaccctgtatacccactactcgcagaaggaagacagcgtctcgctg
tacggcttcctgcgcgagggcgagcggcgcctgttccgcgatgtgcagaaggtcagcggc
atcggcgcgaagatcgcgctggccgtgctgtccggcgtcaccgtcgaggagttcgcgcgc
atggtccaggccggtgacatcaccgcgctgacccgcattccgggcatcggcaagaagacc
gccgagcgcatggtgctggagctgcgtgaccgcgcggcccagttcggtgccggcggcgcg
ctgcccaccggcagcggcccggccccggccgatccgctgtccgacgccaccgtggccctg
cagcagctgggctacaagccggccgaagccgcgcgcatggcccgtgatgccttcaatgaa
ggcgacgaagtggccaccgtgatccgcaaggcgctgcagtcggcgctgcgttga

DBGET integrated database retrieval system