KEGG   Stenotrophomonas maltophilia K279a: Smlt3711Help
Entry
Smlt3711          CDS       T00718                                 

Gene name
ruvA
Definition
(GenBank) putative Holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sml00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Smlt3711 (ruvA)
Enzymes [BR:sml01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Smlt3711 (ruvA)
DNA repair and recombination proteins [BR:sml03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Smlt3711 (ruvA)
    RecFOR pathway proteins
     Smlt3711 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3784504..3785097)
Genome map
AA seq 197 aa AA seqDB search
MIGRLRGIVAYKAPPWLVVDVNGVGYELEAPMSTFYDLPELGREVTLYTHYSQKEDSVSL
YGFLREGERRLFRDVQKVSGIGAKIALAVLSGVTVEEFARMVQAGDITALTRIPGIGKKT
AERMVLELRDRAAQFGAGGALPTGSGPAPADPLSDATVALQQLGYKPAEAARMARDAFNE
GDEVATVIRKALQSALR
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtcgactgcgcggcatcgtcgcctacaaggcgccgccgtggctggtggtggac
gtgaacggagtgggctacgaactggaggcgccgatgagcaccttctacgacctgcccgag
ctcggccgcgaggtcaccctgtatacccactactcgcagaaggaagacagcgtctcgctg
tacggcttcctgcgcgagggcgagcggcgcctgttccgcgatgtgcagaaggtcagcggc
atcggcgcgaagatcgcgctggccgtgctgtccggcgtcaccgtcgaggagttcgcgcgc
atggtccaggccggtgacatcaccgcgctgacccgcattccgggcatcggcaagaagacc
gccgagcgcatggtgctggagctgcgtgaccgcgcggcccagttcggtgccggcggcgcg
ctgcccaccggcagcggcccggccccggccgatccgctgtccgacgccaccgtggccctg
cagcagctgggctacaagccggccgaagccgcgcgcatggcccgtgatgccttcaatgaa
ggcgacgaagtggccaccgtgatccgcaaggcgctgcagtcggcgctgcgttga

DBGET integrated database retrieval system