KEGG   Stenotrophomonas maltophilia K279a: Smlt3887Help
Entry
Smlt3887          CDS       T00718                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Smlt3887
   01230 Biosynthesis of amino acids
    Smlt3887
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smlt3887
   00030 Pentose phosphate pathway
    Smlt3887
   00051 Fructose and mannose metabolism
    Smlt3887
   00052 Galactose metabolism
    Smlt3887
  Energy metabolism
   00680 Methane metabolism
    Smlt3887
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Smlt3887
Protein phosphatases and associated proteins [BR:sml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Smlt3887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3976421..3977716
Genome map
AA seq 431 aa AA seqDB search
MSLQCPFPRAGRRMRNGTLLYAQSGGVTAVINATAAAVIEQARAKGIKVLAARNGILGAL
REELIDTSKESAAAIRALAHTPGGAFGSCRVKLKSLDADRARYDRLLEVLRAHDVRWFLY
NGGNDSADTALKVSQLAKASGYDLTCIGVPKTIDNDLAVTDTCPGFGSAAKYTAVSVREA
ALDVAAMAETSTRVFIYEAMGRHAGWLAAAAGLAGNGDDEAPHIILLPERAYDEAAFLAK
VKAVVERVGYCVVVASEGIATADGRFVADAGGGKDSFGHSQLGGVAAHLAGRVKDQLGLK
VHWALPDYLQRSARHLASRTDWEQAQAVGKAAVQLALKGQNGVMPVIVRSSDAPYRWKIE
AAPLSKIANHEKKMPAGFIRRDGFGITARARAYLSPLIKGEAPLPYGADGLPKYVTLKNV
AVKQKLPPFEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcaatgtcctttcccccgagcaggtagacgcatgcgcaacggtactctcctc
tacgcccaatccggtggtgtcaccgcggtcatcaacgccacggcggcggcggtgatcgag
caggcccgggccaagggcatcaaggtcctggccgcgcgcaacggcatcctcggcgcgctg
cgcgaggaactgatcgacaccagcaaggagagcgctgcggccatccgcgccctcgcccat
accccgggcggcgcgttcggctcctgccgggtcaagctgaaatcgctggatgccgaccgc
gcccgctacgaccgcctgctggaggtgctgcgcgcgcacgacgtgcgctggttcctctac
aacggcggcaacgactcggccgataccgcgctgaaggtctcgcagctggccaaggcctcc
ggctacgacctgacctgcatcggcgtgcccaagaccatcgacaacgacctggcagtgacc
gacacctgccccggcttcggctcggcggccaagtacaccgcggtgtcggtacgcgaggca
gcgctggacgtggcggcgatggccgaaacctccacccgcgtcttcatctacgaagcgatg
ggccgccacgccggctggctggccgcggccgcgggccttgccggcaacggcgatgacgaa
gcgccgcacatcatcctgctgcccgaacgcgcctatgacgaggcggcgttcctggccaag
gtgaaagcggtggtcgagcgcgtcggctactgcgtggtggtggcgtcggagggcatcgcc
accgccgatggccgcttcgtcgctgacgctggcggcggcaaggactcgttcggccactcg
cagctgggcggcgtggccgcgcacctggccggccgggtcaaggaccagctgggcctgaag
gtgcactgggcgctgcccgactacctgcagcgctcggcccggcacctggccagcaggacc
gactgggagcaggcgcaggcggtcggcaaggccgccgtgcagctggcgctgaagggccag
aacggcgtgatgccggtgatcgtacgcagcagcgatgcgccctaccgctggaagatcgaa
gcggcgccactgtcgaagatcgccaaccatgaaaagaagatgcccgccggcttcatccgc
cgcgacggcttcggcatcaccgccagggcgcgggcctatctgtcgccgctgatcaagggc
gaagcgccgctgccgtatggcgccgacggcctgccgaagtacgtcaccctgaagaacgtg
gcggtgaagcagaagctgccgccgttcgagggctga

DBGET integrated database retrieval system