KEGG   Stenotrophomonas maltophilia K279a: Smlt4025Help
Entry
Smlt4025          CDS       T00718                                 

Definition
(GenBank) putative glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
sml00010  Glycolysis / Gluconeogenesis
sml00052  Galactose metabolism
sml00500  Starch and sucrose metabolism
sml00520  Amino sugar and nucleotide sugar metabolism
sml00521  Streptomycin biosynthesis
sml01100  Metabolic pathways
sml01110  Biosynthesis of secondary metabolites
sml01120  Microbial metabolism in diverse environments
sml01130  Biosynthesis of antibiotics
sml01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Smlt4025
   00052 Galactose metabolism
    Smlt4025
   00500 Starch and sucrose metabolism
    Smlt4025
   00520 Amino sugar and nucleotide sugar metabolism
    Smlt4025
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Smlt4025
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Smlt4025
Enzymes [BR:sml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Smlt4025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: CAQ47420
UniProt: B2FUR0
Position
4128141..4129160
Genome map
AA seq 339 aa AA seqDB search
MTASHPAPAHVLSRIAPSFLAADVGGTHVRVARVQASGDAAHPVQVLEYRKYRNADHAGV
SAILSDFLGEGPRPTHCVVASAGYAREDGTVITANLPWPLSARQVEADVGLQRVFIVNDF
EAVAYAAAQVDASGVLHLCGPETAARGPTLVVGPGTGLGAALWIPTAHGPVVLPTEAGQP
TLAASTELEMAIVRHMQRDRAHVSIEHAISGPGLMNLYRAVCALQGQAPTLASPDAVTAA
AVADSDAHARQALDVFCGLLGSTIGDMALFYGAHGGVYLAGGILPQIREYLHASTFVERY
LQKGPMGEALARIPVKVVEHGQLGVVGAASWYLQQQSAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgccagccaccccgccccggcccatgtcctgtcccgaatcgcgccttcgttcctg
gccgccgacgtcggtggcacccatgtgcgcgtggcccgggtccaggccagcggtgatgcc
gcccatccggtgcaggtgctggagtaccgcaagtaccgcaacgccgaccatgcaggcgtc
agcgcgatcctgtccgacttcctcggcgaaggcccgcggcccacgcactgcgtggtcgcc
agtgccggctacgcccgcgaggacggcacggtgatcaccgccaacctgccgtggccgctg
tcggcgcgccaggtggaagccgacgtcggcctgcagcgggtattcatcgtcaacgacttc
gaagccgtggcctatgccgctgcgcaggttgacgccagtggcgtgctgcacctgtgcgga
ccggaaaccgccgcccgcggcccgaccctggtggtcggccccggtaccggcctcggcgcc
gcgctgtggatccccaccgcgcacggcccggtggtgctcccgaccgaagccggccagccg
accctggccgccagcaccgaactggaaatggccatcgtccgccacatgcagcgcgaccgc
gcgcatgtgtcgatcgaacacgcgatctccggcccgggcctgatgaacctgtaccgcgcg
gtgtgcgcactgcagggccaggcgccgaccctggccagccccgacgcggtcaccgctgcg
gccgtggccgacagcgatgcacatgcgcgccaggcgctggatgtgttctgcggcctgctc
ggcagcaccatcggcgacatggcgctgttctacggcgcccatggtggcgtctacctggcc
ggcggcatcctgccgcagatccgcgaatacctgcacgccagcaccttcgtcgaacgctac
ctgcagaaggggccgatgggcgaagcgctggcacgcatcccggtgaaagtcgtcgagcac
ggccagctgggcgtggtcggcgctgccagctggtacctgcagcagcagtcggccgcctga

DBGET integrated database retrieval system