KEGG   Stenotrophomonas maltophilia K279a: Smlt4027Help
Entry
Smlt4027          CDS       T00718                                 

Gene name
nahB
Definition
exported beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sml  Stenotrophomonas maltophilia K279a
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sml00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Smlt4027 (nahB)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Smlt4027 (nahB)
Enzymes [BR:sml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Smlt4027 (nahB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4132124..4134481
Genome map
AA seq 785 aa AA seqDB search
MVKPSRARMRSAVLLGSLLALLPALPALAADPTPATEAPGPLLRADSLMLIPAPASVQRG
QGSGITVRADTVLQAEGEAAQRVASQFADLLARSGGPRLARARGKAAGTSGSIRFQIVPT
FRDSGESYTLESTAQGVLIQAGNETGLFYGATTLAQLATGGSNGVLPAVQIQDAPRFSWR
GFMLDSARHFQSLDEIKRVLDAMAAHKLNTFHWHLTDDQGWRMEIKRYPKLTDVGSCRLP
AGDGGIDPVTGKEHPYCGFYTQDQIREVIAYAAKLHIQVIPEIDVPGHATAAIAAYPELG
TIDTPLKPISEWGVFPNLFNTEDSTVTFLENVLEEVIDLFPAKYVHVGGDEAVKDQWEAS
KQVQQRMRALGIKDEMAMQSHIIKRLETFLEEHDRRLIGWDEILEGGLPPQATVMSWQGT
EGGLAAASAGHDVIMSPVGYLYLDYLQTASPNEPPGRPTQVNLGKLYNFEPVPAELAADK
RGHILGLQANMFTEHTRSYARLQHNLFPRLAAVAETGWSTPEHRDFRDFLARLPSQLQRY
RAWGLAYAQTPFEVGVDYTDNRADNTVTVSLANPLGYEVRYSTDGQPVSAQSPLYQQPLT
GKLPTTVQAAAFYQGQMLAAKPTIATFTAQSLLSRRSDELLSCVGKKGLVLRLEDDGPRE
GNRAVFNVDIFQPCWRWPQAQLDGIGSLEVRAGRIPYYFQLAHDEPKRRFEKAKRPHGEM
LVRRGDCSGKVLAEVPLPAKPDADGFVTLRAALPKGTQGGGDLCINFTGDTRPAMWVLDE
VTLGK
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagccttcccgcgcccggatgcgcagcgcagtgctgctgggcagcctgctcgcc
ctgttgccggcactgccggcacttgccgccgaccccacgcccgccactgaagcacccggc
cccctgctgcgcgccgacagcctgatgctgattcctgccccggccagcgtgcagcgcggc
cagggcagcggcatcaccgtccgcgccgacaccgtgctgcaggccgaaggcgaagccgcg
cagcgcgtcgccagccagttcgccgatctgctggcccgcagcggtggtccgcgccttgca
cgagccaggggcaaggcggcaggcacgtcgggcagcatccgcttccagatcgtgcccacc
ttccgcgacagcggcgaaagctacacgctggagagcaccgcgcagggcgtgctgatccag
gccggcaacgaaaccggcctgttctacggcgcgaccaccctcgcccagctcgccaccggc
ggcagcaatggcgtgctgccggcggtgcagatccaggacgcgccgcgcttcagctggcgc
ggtttcatgctcgattccgcacgtcacttccagagcctggacgagatcaagcgcgtgctc
gatgcgatggccgcgcacaagctcaacaccttccactggcacctgaccgatgaccagggc
tggcgcatggagatcaagcgctatccgaagctgaccgacgtgggcagctgccgcctgccg
gccggcgacggtggcatcgatccggtcactggcaaggagcatccgtattgcggcttctac
acgcaggaccagatccgcgaagtgattgcctatgccgcgaagctgcatatccaggtgatt
ccggaaatcgatgtgccgggccacgcgactgccgcgattgctgcgtatccggagctgggc
accatcgatacgccgttgaagccgatcagcgaatggggcgtgttccccaacctgttcaac
actgaagacagcaccgtcaccttcctcgagaacgtgctggaagaagtgatcgacctgttc
ccggccaagtacgtgcacgtcggtggcgacgaggcggtgaaggaccagtgggaagcgtcg
aagcaggtgcagcagcgcatgcgtgcgctgggcatcaaggatgaaatggccatgcagagc
cacatcatcaagcgcctggagaccttcctggaggagcacgaccggcgcctgatcggctgg
gatgagatcctcgaaggcgggctgccgccgcaggccacggtgatgtcctggcagggcacc
gaaggcggactggctgcggccagcgccggccatgacgtgatcatgtcgccggtcggctac
ctctatctggattacctgcagacggcctcgccgaacgaaccgcccggccgcccgacccag
gtcaacctcggcaagctgtacaacttcgagccggtgccggccgagctggctgctgacaag
cgcgggcacatcctcggactgcaggccaacatgttcaccgagcacacgcgcagctacgca
cgcctgcagcacaacctgttcccacgcctggccgccgtggccgagaccggctggagcacg
ccggaacatcgcgatttccgcgatttcctcgcgcgcctgccgtcccagctgcagcgctac
cgtgcctggggcctggcctatgcgcagaccccgttcgaagtgggcgtggactacaccgac
aatcgcgcggacaacacggtgacggtgtcgctggccaatccgctgggctatgaagtgcgc
tacagcaccgatggccagccggtgagcgcgcagtcaccgctgtaccagcagccgctgacc
ggaaaactgccaaccaccgtgcaggctgccgcgttctaccagggccagatgctggcggcg
aaaccgaccattgccaccttcaccgcacagtcgctgctcagccgccgcagcgatgagctg
ctcagctgcgtgggcaagaagggcctggtgctgcgcctggaagacgatggcccacgcgaa
ggcaaccgtgcggtgttcaacgtggacatcttccagccgtgctggcgctggccgcaggcg
cagttggacggcattggcagcctggaagtccgcgcggggcgtattccgtactacttccag
cttgcccacgatgaacccaagcgtcgcttcgagaaggccaagcggccacacggtgagatg
ctcgtgcgtcgtggcgactgcagcggcaaggtgctggcggaagtgccgttgccggccaag
ccggatgccgatggcttcgtgaccctgcgtgcggcgctgccgaaggggacgcagggcggc
ggtgacctgtgcatcaacttcaccggcgacacgcgcccggcgatgtgggtgctggatgag
gtgaccctggggaaatga

DBGET integrated database retrieval system