KEGG   Schistosoma mansoni: Smp_000020Help
Entry
Smp_000020        CDS       T01095                                 

Definition
Hyaluronidase
Orthology
K15719  
protein O-GlcNAcase / histone acetyltransferase [EC:3.2.1.169 2.3.1.48]
Organism
smm  Schistosoma mansoni
Brite
Enzymes [BR:smm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Smp_000020
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.169  protein O-GlcNAcase
     Smp_000020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 1092 aa AA seqDB search
MANEDSKTFVNKEFLTGVVEGFYGRPWTYPQRKELFRRMNQMGMNAYLYAPKDDIKHRQS
WRDLYTQEEEQQLQFLITESTEAGVLFIFAISPGLDVTFSSAKEVDILKKKVDQVSKLGC
RAFALLFDDIEPRLCPADREVFNSSARAQVMFANEIYNHLGCPDVFLFCPTEYSASLAVP
NINKSEYLATVASCLAPGIAVIWTGPLVVSKRILTKELKELSTLLQHPIVLWDNLHANDY
DQRRVFIGPYSGRPLALRRKGLLRGVLTNPNCEFEANYVAFHTLAQWSRQAGSKHIIQST
DTEMLCTSEDFESNASDDNEVIDDGIDDQKSVDINEHPSVCQDDCVNRKRQYASVYRPRE
ALRIALRDWLALMLQVGASKPSTAIGTPTPMDTDNLETGQNEAPMQIESTPSNVVVISDN
NSSETPISGDVNSVAVTLEDLEMFADLFYLPFSHGPSAIRLLELGHWLREYSYVCGPNPS
DLEKATEWNKKLSDYTDMVSTIGRIRDRIQRLPSKSISYELVPYITEVHTVVGIILDYFR
WLETGVMAFRSMSHLKRLLTWFSPGYRDMVTSGDQEPWTFRGGLITELQRILPLESAQDL
FPAPSRAVPGMTTIPCLNWTDNAASVYTPLAPSVPPMIPIQPSIFPNFSRFPSYIVRPYR
PEDKSCMYGLFRKLLLARVGLPENALPLEFQDLPGDKYLLPFLQHSPESCFMVMGPPFLQ
TSVDCSSSVTNRDHSASGNCVGFGVSAPDAVCWARERTTHYRESMKLKYPRDFQIGVHSL
SHCNKLVVGNGETNNSNLNVTTVTDTTRLEPPVTSSAPLSPLTDSRCSSITPNQNPMAVE
EFIKSMISSFHNDTSEVVDIAAAVNLLPPPEPLGGCLPMEPPLSGCLEQCEPNCTTAPIT
SNIPTDLSSQLELKSSFPIDECGTTIPALPLPTPILPDTAPPSPPSGTICAPSLVPETCS
SSPATTNSVIARNLIVAGGPEALHSALTAHPAIIWIEFDDIGLNSCVNGPTPAMLINHNL
GLCADSPEVLLDSVARRLFICLLAALKTVGAHGAHVQLDTINEHRAELYRRFGFYPVPAA
SNEQTTVLARLI
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgaagacagtaagacatttgtaaataaagaatttcttacaggcgttgttgaa
gggttttatggtcgaccttggacatatcctcaaagaaaagaactgtttcggagaatgaat
caaatgggtatgaatgcttacctgtatgcccctaaggatgatataaaacacagacagtca
tggagggatttgtacactcaagaagaagagcagcaacttcagtttttgatcactgagtcc
actgaagctggagtactttttatttttgctatatcaccgggcttagatgtaacgttttct
agtgctaaagaagtagatattttaaagaaaaaagttgatcaggtttcaaaacttggttgt
cgtgcatttgcccttctttttgatgatattgagccgcgcctatgtcccgcagatcgagaa
gtatttaactcatcagcccgtgctcaggttatgttcgcgaacgaaatttacaatcattta
ggatgtccagatgtctttttattctgtccaacggagtacagtgcaagtttggcagtacct
aatattaataaatcagaatatttagcgacagtcgcttcctgtttagcaccaggtatcgct
gtaatctggaccggtccgcttgtagtgtctaaacgaattttaactaaggagctgaaggaa
ttatctactttattacaacatcctatcgttttatgggacaatctacatgctaatgattat
gaccagcgtcgcgtatttataggaccgtacagtggtcgacccctagctttacgtcgcaaa
ggcttgcttagaggagtgctgaccaatccaaattgtgaatttgaagcaaactatgtggcg
tttcatactcttgcacaatggtctagacaagctggtagcaaacatataatacaatcaact
gatacagaaatgctatgtacaagtgaggattttgaatctaacgcttctgatgataacgaa
gtgattgatgatggtatcgatgatcaaaaatcagtagatattaatgaacacccatctgtc
tgtcaagatgactgtgtaaataggaaacgacaatatgcatctgtttacagacctcgtgaa
gctctccgtatagctttacgagactggcttgcattaatgcttcaggttggtgcttcaaaa
cctagcacggctataggtactcctacacctatggatacagataatcttgaaactggtcaa
aacgaagctcccatgcagattgaatccactccttccaatgtggtcgtgatttctgataat
aattcttctgaaacccctatttcaggtgatgtaaattcagttgctgttaccttagaggat
ttggaaatgtttgctgatcttttctatttacctttctctcatggaccttcagctattcgt
ctactagaattaggacattggttacgcgaatattcgtatgtttgtggacctaacccatct
gatcttgagaaagcaactgaatggaacaaaaagttatcagattatacagatatggtttct
acaattggtcgaatacgagaccgtatacaacgcttaccatctaaaagtatctcttatgaa
ctagtaccatatataactgaagttcatactgtggtgggaattatcctggattatttccga
tggttagaaactggagtcatggcttttcgaagcatgtctcatttaaagcggcttttaaca
tggttttcacctggttaccgtgatatggtaacatctggtgatcaagaaccatggacattt
cgtggtgggttgataacagagcttcagagaattttaccactcgaatctgctcaagatctt
ttccccgcgccaagtcgtgctgtcccaggcatgactaccattccttgtttgaattggact
gataatgcagcaagtgtatacactccacttgctccttctgttcccccaatgattccaatt
cagccttcaatcttcccaaatttttcaaggtttccatcgtatatagttcgaccatataga
cctgaagataaatcatgtatgtatggtttattcagaaaactacttttggctcgtgttggt
ttaccggaaaacgctctcccattagaattccaggatttaccaggtgacaagtatttactt
ccatttctacaacattcacctgaaagttgtttcatggttatgggtccacctttcctgcag
acctcagttgattgctctagttcagtcacaaatagggatcattctgcctcaggtaattgt
gttggctttggtgtttcagcaccggatgctgtatgttgggctcgtgaacgtactactcac
tatcgagagtcaatgaaattaaaatatccacgtgactttcaaatcggagtacacagttta
tcgcattgtaacaaattagtcgttggaaatggtgagaccaacaactctaacttgaatgtt
actactgtaactgatactactcgattggaacctcctgtaacttcatctgctccactctcc
cctttaacagatagtcgttgttcaagcattactccaaatcaaaatcctatggctgtcgaa
gaattcatcaagtctatgatttcttctttccacaatgatacatctgaagttgttgatatt
gctgcagctgtgaatttactccctcctcctgaaccacttggtggatgccttcctatggag
ccaccactatctggttgtttggaacaatgtgaacctaattgtacgactgctccaattact
tcaaatattccgactgatttgtcatctcaattagaactaaaatcttcttttcctattgat
gaatgtggtacaactatcccagctttacctttgcctacacctattttaccagatactgct
cctccatctccaccgtctggaactatttgtgcaccatcattagtgcctgagacatgttca
agtagtcctgcaacaacaaattcagtgatagctcggaatcttattgttgctggtggacca
gaagcacttcatagtgctttaacagctcatcccgctattatatggattgaatttgatgat
ataggattaaatagttgtgttaatggtcctacacctgctatgcttattaatcataatctt
ggattatgtgcagattcacctgaagtgttgttggattctgtagcacgtcgattgtttatt
tgtttgttagctgcattaaagacagttggcgctcatggagcacatgtacagttggatact
atcaatgaacatcgagcagaactttatcgacgttttggtttttatcctgttccagcagct
tcaaatgaacaaacaactgttttagctcgtttaatttga

DBGET integrated database retrieval system