KEGG   Schistosoma mansoni: Smp_000100Help
Entry
Smp_000100        CDS       T01095                                 

Definition
filamin
Orthology
K04437  
filamin
Organism
smm  Schistosoma mansoni
Brite
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Smp_000100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 2414 aa AA seqDB search
MDYPDPDAGYVDEDEEEIPMAERELAEDAEWKLIQKNTFTRWANEHLKPKNVTVDDLQFD
LADGLRLIALVESLSGQQFKHVNRKPSFRTQKLENVTMVLRFLEENEGLRLVNIDSSDIV
DCRSKLILGLIWTLILHYSITIPLWEGEPDFGAQGPTPKQRLLSWLNNKLADRPVKNFTT
DWNDGIAIGALVDACAPGLCPDWREWEPKQNLRNAREAMGAAEQWLDVPQLIHPEEMTNP
RVDEKAMMTYLSQFPSAKLKDGAPLRPKSNPGLVRAYGPGLEPHGNTVGNPARFTIDTFS
AGRGAVEVIVLNPKGQREPCDVLSNNDKQQTYSCAYVPTQEGEYRVIIKFATKEILNSPF
KVMVEGAQGDGSKATASGPGIEPTGNQVGRRTFFNIFTAAAGPGNADCVILDPHGRRDSI
KPLITRQGEDNYLVEYTPKDEGLHSVNVFYAGQQISNSPFGVMVGPPCDPKQAYATGRGI
QPQGIRVKDLADFKVHTEDAGEGPLEVSVIAPDGRGIPCTSRKTGAYLFDCSYTPQRPGT
HQVNVRYGGDHIMLSPFTVEVAPYKESRIRAFGPGLVGGVVNKPAVFVVETNGETGALGF
SIEGPSEARIDCTDNGDGSATVAYWPTAPGEYAVHILCNDENIPKSPFMVPIEPDMGKCD
PERVKAHGPGIMPTGNVAGQPTEFTVDIRDSGGPAPLTVECRDNEGEPVALKVRDNGDGT
YTCSYTPKVPKKHTVLVSYGGVNIPRSPFRVEVAEPSNPGKVRVFGPGVENVTRGQPTYF
TVDCKQAGHGNVGISVTDEAGRDVAMDTQDMRDGTFKVAYTANTPGPYYTVQVFFNNQEV
PRSPFKVPVKPNIDMSKIHVENLEPNITTGVPTEFDVITAGAGPPNNSKPKPTVTVKSPN
GMRVPCTLAESVDGYTPSFTPTVVGPHTVAVEVGGVPVKGSPFRTNAIPPAAVQEPIYPK
DFGRQQATSAPISGPEAAALVRAYGDGLYRATAGKQAKFTIDSQDAPPAPLSVTIEGPAE
AKINYNDNGDGTCGVDYLPTEPGPYIVNVLYKDTHIKGSPFPVRVAPLGREHIDVSRVHA
YGPGLQPTGVFKESFAKFTVDAKAVDPQSRGIVKAIVVSPNKQRTACLIQNNGDGTYKCS
YSPIDDGLHHVEVTYDGAPVPGSPFPVNVAPGCDPTRVRAYGPGLEGGFTHEPQRFTVDL
DGAGQGALGLALEGPADAQIQCQDNKDGTCTVDYLPTRAGTYDIFVKFNDMNIPGSPFQV
PIRDVVDPTRVRCYGPGLEPRGARAQQPAHFTVDASQAGDAPIQVIIQSYLITFLKNRVL
VRSSNQWSSNHVCCEIGTHRRQLVNGCSTSDQLKLDINTVGCRLSGLSVKGSGSRLVGPG
SESRECGDPDGQPLQLEVVDVGDGTYVCHYTPMIVGRHTVRVKYGGQEIPESPFLVPVAP
SGRSNMCRIENGNDSRIPVGQECVISVNTQQAGVGQLTCRIVTPSGATADVEIHEAPNGR
VNIYYTPPIRGDYLVEIRFGGELIPNGRFNQKDQRVQHVTVQSVQSVQSSTVTTGYHPVD
FKLPVGPTFSHVEGLVRTPSGRILHPTLLDNGDGTVTAQFQPNEPGLHELEITYNGQPIP
GSPFRFYVEAVGSGIVTAYGPGLSCGRAGEPSNFTLITRDAGAGGLSLSVEGPSKADIQC
DDNKNGTCSVSYLPLVPGEYTISIKFMENHIPGSPFTAHIAGESRRFNQVCVGTTSEMPL
RITETDIYNLVATVRSPSGHEQPSTLKRLPNGHLGISFTPHEIGEHFVNVFRNGRHIANS
PFKIYVGENEIGNASKVRIYGNGLREGMANQNCQFTVDTRNAGYGGLNLSIEGPSKADIE
CHDNQDGTCLVTYRPTEPGTYIINVKYAEQPVPGSPFVVHIGGEPSLRMMERITRQRELA
DATYVGSQCELNLKIPGINIRDLTANVTSPSGVSQRCDVLAMDDVNYTIKFVPQEMGVHT
VSVRHRGSHISGSPFQFTVGPITEGGAHKVHATGQGLQNGLTYSLNDFSIYTREAGAGGL
SIAIEGPSKAEINFEDRKDGSCGVSYRVTEPGEYLCSIRFNDDHIPNSPFRVIINEAMER
TFYTPETKLLNITSIQDRGLSVGRPTAFTVNYSGMTGRMRAYVVAPSGIQSDAFVHQVDV
DQHAVRFTPHENGAHLVHVLMDERPVPGSPFRVLVGQEETGHVTASGEGLTHGRVGERNR
FFVNTVQAGSGALSVTVDGPSKVQLNCTERSDGYDFTYLPLSPGEYLISIKYGDSQHIIG
SPYKAIVTGDAVHETITTDTTHVVVETGGRMVNGPHSNFGPSRPDRVTCSGPGLKQAYLN
EANTFTVNASQAGHDVLYVGVSGPVVACEEVNIKHMGYGQYSISYTVRDRGRHLIMIKWG
DQHVPGSPFTVDVI
NT seq 7245 nt NT seq  +upstreamnt  +downstreamnt
atggactatccagatccagatgccggttatgtggatgaagatgaagaagagataccaatg
gctgagagggaattggctgaagatgctgaatggaagcttattcaaaaaaacactttcacg
agatgggcaaatgaacatcttaaacctaaaaatgttactgtagatgatcttcaatttgat
ttagctgatggtcttcgtttgattgcattggttgagtcattatctggacaacaatttaaa
catgttaatagaaaaccaagttttcgtacccagaaattagaaaatgttacaatggtttta
agatttcttgaagagaatgaaggtctacgactagtgaatatagatagttcagatattgtt
gactgtcgtagtaagcttattcttggtctaatttggactcttattttgcattattcaata
acaatcccactttgggaaggtgaacctgattttggagctcaaggcccaacaccaaaacaa
cgtctcttatcttggttaaataataaactagctgatcgaccagttaaaaatttcacaaca
gattggaatgatggtattgcaatcggtgcactagttgatgcttgtgcaccaggtttatgc
cctgattggcgagaatgggaacctaaacaaaatcttcgtaatgctcgtgaagcaatgggt
gcagctgaacaatggttagatgttccacaattaatacatccagaagagatgactaatcct
agagttgatgaaaaagctatgatgacatatttaagtcaatttcctagtgctaaactaaaa
gatggtgcacctttaagaccaaaatcaaatcctggccttgttcgggcttatggtcctggt
ctcgaaccacatggaaatactgttggaaatcctgcacggttcactattgatacattcagt
gctggtcggggtgctgttgaagtgattgtgctgaatcctaaaggacaaagagaaccatgt
gatgtactcagtaataacgataaacaacaaacttattcttgtgcctatgttccaacacaa
gaaggtgaatacagggttattattaaatttgccaccaaagaaattttaaattcaccattt
aaagttatggtagaaggtgcacaaggtgatggaagtaaagcaactgcatctggtccagga
attgaaccaactgggaatcaagttggtcgacgaacattcttcaatatattcactgccgct
gctggacctggaaatgcggattgtgtaattctagatcctcatggtcgacgtgattctatt
aaacctttaataactcgtcaaggtgaagataattatcttgtggaatatacaccaaaagat
gaaggtcttcattcagttaacgtattttatgctggtcaacaaatatctaattcaccattt
ggtgtgatggttggtccaccctgtgatccaaaacaagcttatgccacaggtcgaggaatt
caacctcaaggtatacgagtcaaagatttggctgatttcaaagtacatacagaagatgct
ggtgaaggtccactagaagtgtctgtaattgctccagatggtagaggaattccttgcaca
agtcgaaaaactggtgcctatttgttcgattgtagctatacaccacaaagaccaggtaca
catcaagttaatgttcgatatggtggagatcatattatgctaagtccattcacggtggaa
gttgctccttacaaagaatcccgtataagagcatttggtccaggtctcgttggtggtgtt
gtcaataaaccagctgttttcgttgtggaaacaaatggtgaaactggagctctaggtttt
tcaattgaaggtccaagtgaagcaagaattgattgtacagataatggagatggatcagcc
actgtagcttattggccaacagctcctggtgaatatgcagttcacattttatgtaatgat
gaaaatataccaaaatctcctttcatggttccaattgaaccagatatgggtaaatgtgat
cctgaaagagttaaagcacatggaccaggtataatgccaactgggaacgttgctggtcaa
ccaactgaatttacagtagatattagagattctggtggtcctgccccattaacagttgaa
tgcagagacaatgaaggtgaaccagttgcactgaaagttcgtgataatggcgatggtact
tatacatgtagctatacacctaaagttcccaaaaaacacacagttcttgtttcctacggt
ggagtcaatatacctagaagtcctttcagagttgaagtagctgaacctagtaatccagga
aaagtacgcgtttttggtccaggtgtagaaaatgttactagaggtcaaccaacctatttc
acagtagattgtaaacaggctggacatggtaatgttgggatcagtgtcaccgatgaagct
ggacgtgatgttgctatggatacacaagatatgagagatggaacatttaaagttgcttat
acagctaatacaccaggaccttattatactgtacaagtatttttcaataatcaagaagtt
ccacgtagtccatttaaagtacctgttaaaccaaatatcgatatgtcgaaaattcatgtt
gaaaatcttgaaccaaatatcactactggtgtaccaacggagtttgatgtaataactgcg
ggtgcaggcccaccaaataatagtaaaccgaaaccaactgtaacagtaaaatctccaaac
ggtatgcgtgtaccatgcactttagctgaaagcgtagatggatatacaccttcctttaca
ccaactgttgttgggcctcatactgttgctgttgaagttggaggtgtaccagtcaaaggt
agtccatttcgtacaaacgctattccacctgctgcagtgcaagagcctatctatccaaaa
gattttggacgtcagcaggctacttcagcacctatttctggacctgaagcagcagctttg
gtccgcgcttatggtgacggactttatcgtgcaacagctggaaagcaggcgaaattcaca
atcgatagtcaagatgctccacctgctccactaagcgtcacaattgaaggacctgcagaa
gctaaaataaattataatgataacggcgatggaacatgtggcgtagattatttaccaact
gaaccaggaccatatattgtaaatgttttatacaaagatacacacattaaaggaagtcca
ttccctgtaagagtagctccacttggaagagaacatatcgatgtatcccgagtacatgcc
tacggtcctggattacagccaactggtgttttcaaagaatcatttgctaaattcacagtt
gatgctaaagcagttgatccacaaagtaggggaatagtcaaagctattgtggttagtccg
aataaacaaagaacagcatgcttaatacaaaacaatggcgatggaacatacaaatgcagt
tattctccaatagatgatggcttacatcacgttgaggttacctatgatggagcaccagta
cctggtagtcccttcccagtaaatgttgctcctggatgtgatccaacaagagtaagagct
tacggtccaggcttagaaggagggttcactcatgagccacaaagatttacggttgactta
gatggtgcgggtcaaggtgcccttgggttagctttagaagggccagctgacgctcaaata
caatgtcaagataataaagatggaacatgtacagtggactacttaccaacacgggcagga
acatatgatatcttcgttaaatttaacgatatgaatattccaggcagtccattccaagtt
cccatacgagatgtggttgacccaactcgtgttcgttgttatggtccaggtctagagccc
agaggagcacgagcgcaacaaccagctcactttactgttgatgcttcacaggcaggagat
gcgcctatccaagtaattattcagagttatttaataactttccttaaaaatcgagttcta
gtgagaagcagtaaccagtggagttcaaaccacgtctgttgtgagataggaactcacaga
agacaattggtgaacggttgttcaacatcggatcagttgaagttagacattaacaccgtt
ggatgccggctcagtggtctatcggttaagggctctggctcgagactggtaggacctggg
tccgaatctcgcgagtgcggggatcctgatggtcaaccattacaattagaagtagtggat
gttggagatggaacatatgtatgtcattatacaccaatgattgttggacgtcatactgta
cgagtgaaatatggtgggcaagaaattcctgaaagtccattcctagtaccagttgcacca
tctggacgatctaatatgtgtcgtatagaaaatggaaatgatagccgaatacctgttggt
caagaatgtgttatcagtgtgaatacacaacaagctggtgttggacagttaacttgtcgt
attgttacaccatctggagcaacagccgatgttgaaattcatgaagcaccaaacggtcga
gttaatatttactatacaccaccaattcgtggtgattatttggttgagataagatttggc
ggtgaacttataccaaatggaaggtttaaccaaaaagatcaaagagtacaacatgtaact
gtacaatctgtgcagtctgtccagtcttcaacggtcacaacaggatatcacccagttgac
tttaaactacctgttggcccaacatttagtcatgtggaaggtttggttcgtactccaagt
ggtcgaattctacatccgactttattggataatggtgatggaacagttacagcacaattt
caaccaaatgaacctggactccatgaattagaaataacttataatggtcaaccaatacca
ggtagtcctttcagattctatgttgaagctgttggatctggaattgttacagcttatgga
ccaggattatcttgtggtcgtgctggagaaccatcaaatttcactttaattacacgcgat
gctggagcaggcggattgtcactttccgttgaaggaccatccaaagccgatattcaatgt
gatgataataaaaatggtacttgtagtgtaagctatttaccattagtacctggtgagtat
acaatatcgattaaattcatggagaatcatatacctggttcaccattcacagcacacata
gcaggtgaatcacgcagattcaatcaagtttgtgtcggtactactagtgaaatgccgttg
cgtattacagaaacagatatttataatcttgttgcaaccgtccgtagcccatctggacat
gaacaaccatcaacattaaaaagactgccaaacggacatctaggtatttcatttacacct
catgaaattggtgaacattttgttaatgtattccgtaatggtcgacatattgccaatagt
ccatttaaaatttatgttggtgaaaatgaaattggtaatgcatctaaagttcgtatttat
ggtaatggattaagagaaggtatggcaaatcaaaattgtcaattcactgttgatacaaga
aatgctggttacggtggcttgaatctatcaattgaaggaccaagtaaagcagatattgaa
tgccatgataaccaagatggtacatgtttagttacatatcgtccaactgaacctggaaca
tatataatcaatgttaaatacgctgaacaaccagtgccaggcagtccttttgtagttcat
attggtggtgaaccatcacttagaatgatggaaagaattacacgacaaagagaacttgct
gatgcaacatatgtaggcagtcaatgtgaattaaatttgaaaattccaggaataaatatt
cgtgatttaacagctaatgtaactagtccatcaggagtaagtcaacgatgtgatgtctta
gctatggatgatgtgaactataccattaaatttgtaccacaagaaatgggtgtacatact
gtttcagtacgtcatcgaggatctcatatttctggaagtccatttcagtttacagttggt
cctattacagaaggtggagcgcataaagtacatgctaccggtcaaggattacaaaatggt
ttaacctattcactaaatgattttagtatttatactcgtgaagccggtgcaggtggttta
tcaattgctattgaaggaccaagtaaagccgaaataaatttcgaagataggaaagatggc
tcatgtggagtttcttatcgtgtaactgaaccaggtgaatatttatgctctattcgcttc
aatgatgatcatataccgaattcaccatttcgtgttatcataaatgaagcgatggaacga
acattctatacacctgaaactaaattattgaatattacaagtattcaagatcgtggtctg
tcggtcgggcgtccaacagcattcacagttaattactcaggaatgacaggtagaatgaga
gcatatgtagtagctccatctggaatacagtcagatgcatttgtacaccaagtggatgtt
gatcaacatgcagtaagatttacacctcatgaaaatggagcacatttagtgcatgtactc
atggatgaacgtccagtacctggaagtccattccgtgtattggttggacaagaagagact
ggtcatgttacagctagtggggaaggtttgactcatggacgtgttggtgagcgtaatcga
tttttcgtaaacactgttcaagctggaagtggtgctttatcagttactgtggatggtcct
agtaaagttcaattaaattgtactgaacgatcagatggatacgatttcacttatttgcca
ttatcgcctggtgaatatctcatcagtattaaatatggtgattcacaacatattataggt
tcaccatataaagcaattgtgacaggagatgctgtacacgaaacaatcacaactgataca
acacatgttgtagtagaaacaggaggacgtatggttaatggaccacattctaattttggt
ccatctagaccagatcgtgttacatgctctggaccgggacttaaacaagcatatcttaat
gaagctaatacatttacagttaatgcatcacaagcaggtcatgatgtactgtatgttgga
gtatctggaccagttgtagcctgtgaagaagtcaatattaaacatatgggttatggtcaa
tattcaattagttatactgtacgtgatcgtggtcgtcatttaattatgattaaatggggt
gatcaacatgtaccaggcagtccattcactgttgatgttatctaa

DBGET integrated database retrieval system