KEGG   Schistosoma mansoni: Smp_000100Help
Entry
Smp_000100        CDS       T01095                                 

Definition
(RefSeq) filamin
  KO
K04437  
filamin
Organism
smm  Schistosoma mansoni
Brite
Cytoskeleton proteins [BR:smm04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     Smp_000100
  Intermediate filaments
   Intermediate filament-binding proteins
    Smp_000100
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Smp_000100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
Position
3
AA seq 2336 aa AA seqDB search
MGAAEQWLDVPQLIHPEEMTNPRVDEKAMMTYLSQFPSAKLKDGAPLRPKSNPGLVRAYG
PGFQYLIEVDVDHELLTTTTTTTSTTTTTTTGILPSVKVISTTLDKNFENTKKQKFTELN
SNNSTDRHGLGVIYALNRQSFSCYLFFFGTKMKKHNSPSSLKQNLKSSHGDKVNSNVKGL
EPHGNTVGNPARFTIDTFSAGRGAVEVIVLNPKGQREPCDVLSNNDKQQTYSCAYVPTQE
GEYRVIIKFATKEILNSPFKVMVEGAQGDGSKATASGPGIEPTGNQVGRRTFFNIFTAAA
GPGNADCVILDPHGRRDSIKPLITRQGEDNYLVEYTPKDEGLHSVNVFYAGQQISNSPFG
VMVGPPCDPKQAYATGRGIQPQGIRVKDLADFKVHTEDAGEGPLEVSVIAPDGRGIPCTS
RKTGAYLFDCSYTPQRPGTHQVNVRYGGDHIMLSPFTVEVAPYKESRIRAFGPGLVGGVV
NKPAVFVVETNGETGALGFSIEGPSEARIDCTDNGDGSATVAYWPTAPGEYAVHILCNDE
NIPKSPFMVPIEPDMGKCDPERVKAHGPGIMPTGNVAGQPTEFTVDIRDSGGPAPLTVEC
RDNEGEPVALKVRDNGDGTYTCSYTPKVPKKHTVLVSYGGVNIPRSPFRVEVAEPSNPGK
VRVFGPGVENVTRGQPTYFTVDCKQAGHGNVGISVTDEAGRDVAMDTQDMRDGTFKVAYT
ANTPGPYYTVQVFFNNQEVPRSPFKVPVKPNIDMSKIHVENLEPNITTGVPTEFDVITAG
AGPPNNSKPKPTVTVKSPNGMRVPCTLAESVDGYTPSFTPTVVGPHTVAVEVGGVPVKGS
PFRTNAIPPAAVQEPIYPKDFGRQQATSAPISGPEAAALVRAYGDGLYRATAGKQAKFTI
DSQDAPPAPLSVTIEGPAEAKINYNDNGDGTCGVDYLPTEPGPYIVNVLYKDTHIKGSPF
PVRVAPLGREHIDVSRVHAYGPGLQPTGVFKESFAKFTVDAKAVDPQSRGIVKAIVVSPN
KQRTACLIQNNGDGTYKCSYSPIDDGLHHVEVTYDGAPVPGSPFPVNVAPGCDPTRVRAY
GPGLEGGFTHEPQRFTVDLDGAGQGALGLALEGPADAQIQCQDNKDGTCTVDYLPTRAGT
YDIFVKFNDMNIPGSPFQVPIRDVVDPTRVRCYGPGLEPRGARAQQPAHFTVDASQAGDA
PIQVATVDRVGRTAPAHVVPRPNQPGVYDVTYVPDTDGPCQIEVKQAGNHVARSPFTQHV
LPAFEPQRVRVTGEGVHPTRPLGLPATQPTSFQVDTRDAGLGDLELSVMDPDGQPLQLEV
VDVGDGTYVCHYTPMIVGRHTVRVKYGGQEIPESPFLVPVAPSGRSNMCRIENGNDSRIP
VGQECVISVNTQQAGVGQLTCRIVTPSGATADVEIHEAPNGRVNIYYTPPIRGDYLVEIR
FGGELIPNGRFNQKDQRVQHVTVQSVQSVQSSTVTTGYHPVDFKLPVGPTFSHVEGLVRT
PSGRILHPTLLDNGDGTVTAQFQPNEPGLHELEITYNGQPIPGSPFRFYVEAVGSGIVTA
YGPGLSCGRAGEPSNFTLITRDAGAGGLSLSVEGPSKADIQCDDNKNGTCSVSYLPLVPG
EYTISIKFMENHIPGSPFTAHIAGESRRFNQVCVGTTSEMPLRITETDIYNLVATVRSPS
GHEQPSTLKRLPNGHLGISFTPHEIGEHFVNVFRNGRHIANSPFKIYVGENEIGNASKVR
IYGNGLREGMANQNCQFTVDTRNAGYGGLNLSIEGPSKADIECHDNQDGTCLVTYRPTEP
GTYIINVKYAEQPVPGSPFVVHIGGEPSLRMMERITRQRELADATYVGSQCELNLKIPGI
NIRDLTANVTSPSGVSQRCDVLAMDDVNYTIKFVPQEMGVHTVSVRHRGSHISGSPFQFT
VGPITEGGAHKVHATGQGLQNGLTYSLNDFSIYTREAGAGGLSIAIEGPSKAEINFEDRK
DGSCGVSYRVTEPGEYLCSIRFNDDHIPNSPFRVIINEAMERTFYTPETKLLNITSIQDR
GLSVGRPTAFTVNYSGMTGRMRAYVVAPSGIQSDAFVHQVDVDQHAVRFTPHENGAHLVH
VLMDERPVPGSPFRVLVGQEETGHVTASGEGLTHGRVGERNRFFVNTVQAGSGALSVTVD
GPSKVQLNCTERSDGYDFTYLPLSPGEYLISIKYGDSQHIIGSPYKAIVTGDAVHETITT
DTTHVVVETGGRMVNGPHSNFGPSRPDRVTCSGPGLKQAYLNEANTFTVNASQAGHDVLY
VGVSGPVVACEEVNIKHMGYGQYSISYTVRDRGRHLIMIKWGDQHVPGSPFTVDVI
NT seq 7011 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcagctgaacaatggttagatgttccacaattaatacatccagaagagatgact
aatcctagagttgatgaaaaagctatgatgacatatttaagtcaatttcctagtgctaaa
ctaaaagatggtgcacctttaagaccaaaatcaaatcctggccttgttcgggcttatggt
cctggatttcaatatttaattgaagtagatgtggatcatgaattattaactactactact
actactactagtactacaacaacaactactactggtatattaccttcagtgaaagtaata
tctactacattggataaaaattttgaaaatacaaaaaaacaaaaatttacagaacttaat
tctaataatagtactgatcgtcatggattaggtgtaatttatgcattaaatcgtcaatca
ttttcatgttatttatttttttttggtacaaaaatgaaaaaacataattcaccatcatca
ttaaaacaaaatttaaaatcatctcatggtgataaagtaaattcaaatgtgaaaggtctc
gaaccacatggaaatactgttggaaatcctgcacggttcactattgatacattcagtgct
ggtcggggtgctgttgaagtgattgtgctgaatcctaaaggacaaagagaaccatgtgat
gtactcagtaataacgataaacaacaaacttattcttgtgcctatgttccaacacaagaa
ggtgaatacagggttattattaaatttgccaccaaagaaattttaaattcaccatttaaa
gttatggtagaaggtgcacaaggtgatggaagtaaagcaactgcatctggtccaggaatt
gaaccaactgggaatcaagttggtcgacgaacattcttcaatatattcactgccgctgct
ggacctggaaatgcggattgtgtaattctagatcctcatggtcgacgtgattctattaaa
cctttaataactcgtcaaggtgaagataattatcttgtggaatatacaccaaaagatgaa
ggtcttcattcagttaacgtattttatgctggtcaacaaatatctaattcaccatttggt
gtgatggttggtccaccctgtgatccaaaacaagcttatgccacaggtcgaggaattcaa
cctcaaggtatacgagtcaaagatttggctgatttcaaagtacatacagaagatgctggt
gaaggtccactagaagtgtctgtaattgctccagatggtagaggaattccttgcacaagt
cgaaaaactggtgcctatttgttcgattgtagctatacaccacaaagaccaggtacacat
caagttaatgttcgatatggtggagatcatattatgctaagtccattcacggtggaagtt
gctccttacaaagaatcccgtataagagcatttggtccaggtctcgttggtggtgttgtc
aataaaccagctgttttcgttgtggaaacaaatggtgaaactggagctctaggtttttca
attgaaggtccaagtgaagcaagaattgattgtacagataatggagatggatcagccact
gtagcttattggccaacagctcctggtgaatatgcagttcacattttatgtaatgatgaa
aatataccaaaatctcctttcatggttccaattgaaccagatatgggtaaatgtgatcct
gaaagagttaaagcacatggaccaggtataatgccaactgggaacgttgctggtcaacca
actgaatttacagtagatattagagattctggtggtcctgccccattaacagttgaatgc
agagacaatgaaggtgaaccagttgcactgaaagttcgtgataatggcgatggtacttat
acatgtagctatacacctaaagttcccaaaaaacacacagttcttgtttcctacggtgga
gtcaatatacctagaagtcctttcagagttgaagtagctgaacctagtaatccaggaaaa
gtacgcgtttttggtccaggtgtagaaaatgttactagaggtcaaccaacctatttcaca
gtagattgtaaacaggctggacatggtaatgttgggatcagtgtcaccgatgaagctgga
cgtgatgttgctatggatacacaagatatgagagatggaacatttaaagttgcttataca
gctaatacaccaggaccttattatactgtacaagtatttttcaataatcaagaagttcca
cgtagtccatttaaagtacctgttaaaccaaatatcgatatgtcgaaaattcatgttgaa
aatcttgaaccaaatatcactactggtgtaccaacggagtttgatgtaataactgcgggt
gcaggcccaccaaataatagtaaaccgaaaccaactgtaacagtaaaatctccaaacggt
atgcgtgtaccatgcactttagctgaaagcgtagatggatatacaccttcctttacacca
actgttgttgggcctcatactgttgctgttgaagttggaggtgtaccagtcaaaggtagt
ccatttcgtacaaacgctattccacctgctgcagtgcaagagcctatctatccaaaagat
tttggacgtcagcaggctacttcagcacctatttctggacctgaagcagcagctttggtc
cgcgcttatggtgacggactttatcgtgcaacagctggaaagcaggcgaaattcacaatc
gatagtcaagatgctccacctgctccactaagcgtcacaattgaaggacctgcagaagct
aaaataaattataatgataacggcgatggaacatgtggcgtagattatttaccaactgaa
ccaggaccatatattgtaaatgttttatacaaagatacacacattaaaggaagtccattc
cctgtaagagtagctccacttggaagagaacatatcgatgtatcccgagtacatgcctac
ggtcctggattacagccaactggtgttttcaaagaatcatttgctaaattcacagttgat
gctaaagcagttgatccacaaagtaggggaatagtcaaagctattgtggttagtccgaat
aaacaaagaacagcatgcttaatacaaaacaatggcgatggaacatacaaatgcagttat
tctccaatagatgatggcttacatcacgttgaggttacctatgatggagcaccagtacct
ggtagtcccttcccagtaaatgttgctcctggatgtgatccaacaagagtaagagcttac
ggtccaggcttagaaggagggttcactcatgagccacaaagatttacggttgacttagat
ggtgcgggtcaaggtgcccttgggttagctttagaagggccagctgacgctcaaatacaa
tgtcaagataataaagatggaacatgtacagtggactacttaccaacacgggcaggaaca
tatgatatcttcgttaaatttaacgatatgaatattccaggtagtccattccaagttccc
atacgagatgtggttgacccaactcgtgttcgttgttatggtccaggtctagagcccaga
ggagcacgagcgcaacaaccagctcactttactgttgatgcttcacaggcaggagatgcg
cctatccaagtcgcaacagttgatcgtgttggaagaacagcaccggcacatgttgttcca
cggccaaatcaaccaggtgtctatgatgtgacatatgttccagataccgacggtccatgt
caaattgaagttaaacaagcaggaaatcatgtagctcgatcaccattcacacaacatgtc
ttaccagcttttgaaccacaacgtgtgcgtgtaacaggtgaaggcgttcatccaactcgt
ccattaggacttccagctactcaaccgacttctttccaagtagatacaagagatgcaggt
ctcggagacctagaattatcagtaatggatcctgatggtcaaccattacaattagaagta
gtggatgttggagatggaacatatgtatgtcattatacaccaatgattgttggacgtcat
actgtacgagtgaaatatggtgggcaagaaattcctgaaagtccattcctagtaccagtt
gcaccatctggacgatctaatatgtgtcgtatagaaaatggaaatgatagccgaatacct
gttggtcaagaatgtgttatcagtgtgaatacacaacaagctggtgttggacagttaact
tgtcgtattgttacaccatctggagcaacagccgatgttgaaattcatgaagcaccaaac
ggtcgagttaatatttactatacaccaccaattcgtggtgattatttggttgagataaga
tttggcggtgaacttataccaaatggaaggtttaaccaaaaagatcaaagagtacaacat
gtaactgtacaatctgtgcagtctgtccagtcttcaacggtcacaacaggatatcaccca
gttgactttaaactacctgttggcccaacatttagtcatgtggaaggtttggttcgtact
ccaagtggtcgaattctacatccgactttattggataatggtgatggaacagttacagca
caatttcaaccaaatgaacctggactccatgaattagaaataacttataatggtcaacca
ataccaggtagtcctttcagattctatgttgaagctgttggatctggaattgttacagct
tatggaccaggattatcttgtggtcgtgctggagaaccatcaaatttcactttaattaca
cgcgatgctggagcaggcggattgtcactttccgttgaaggaccatccaaagccgatatt
caatgtgatgataataaaaatggtacttgtagtgtaagctatttaccattagtacctggt
gagtatacaatatcgattaaattcatggagaatcatatacctggttcaccattcacagca
cacatagcaggtgaatcacgcagattcaatcaagtttgtgtcggtactactagtgaaatg
ccgttgcgtattacagaaacagatatttataatcttgttgcaaccgtccgtagcccatct
ggacatgaacaaccatcaacattaaaaagactgccaaacggacatctaggtatttcattt
acacctcatgaaattggtgaacattttgttaatgtattccgtaatggtcgacatattgcc
aatagtccatttaaaatttatgttggtgaaaatgaaattggtaatgcatctaaagttcgt
atttatggtaatggattaagagaaggtatggcaaatcaaaattgtcaattcactgttgat
acaagaaatgctggttacggtggcttgaatctatcaattgaaggaccaagtaaagcagat
attgaatgccatgataaccaagatggtacatgtttagttacatatcgtccaactgaacct
ggaacatatataatcaatgttaaatacgctgaacaaccagtgccaggcagtccttttgta
gttcatattggtggtgaaccatcacttagaatgatggaaagaattacacgacaaagagaa
cttgctgatgcaacatatgtaggcagtcaatgtgaattaaatttgaaaattccaggaata
aatattcgtgatttaacagctaatgtaactagtccatcaggagtaagtcaacgatgtgat
gtcttagctatggatgatgtgaactataccattaaatttgtaccacaagaaatgggtgta
catactgtttcagtacgtcatcgaggatctcatatttctggaagtccatttcagtttaca
gttggtcctattacagaaggtggagcgcataaagtacatgctaccggtcaaggattacaa
aatggtttaacctattcactaaatgattttagtatttatactcgtgaagccggtgcaggt
ggtttatcaattgctattgaaggaccaagtaaagccgaaataaatttcgaagataggaaa
gatggctcatgtggagtttcttatcgtgtaactgaaccaggtgaatatttatgctctatt
cgcttcaatgatgatcatataccgaattcaccatttcgtgttatcataaatgaagcgatg
gaacgaacattctatacacctgaaactaaattattgaatattacaagtattcaagatcgt
ggtctgtcggtcgggcgtccaacagcattcacagttaattactcaggaatgacaggtaga
atgagagcatatgtagtagctccatctggaatacagtcagatgcatttgtacaccaagtg
gatgttgatcaacatgcagtaagatttacacctcatgaaaatggagcacatttagtgcat
gtactcatggatgaacgtccagtacctggaagtccattccgtgtattggttggacaagaa
gagactggtcatgttacagctagtggggaaggtttgactcatggacgtgttggtgagcgt
aatcgatttttcgtaaacactgttcaagctggaagtggtgctttatcagttactgtggat
ggtcctagtaaagttcaattaaattgtactgaacgatcagatggatacgatttcacttat
ttgccattatcgcctggtgaatatctcatcagtattaaatatggtgattcacaacatatt
ataggttcaccatataaagcaattgtgacaggagatgctgtacacgaaacaatcacaact
gatacaacacatgttgtagtagaaacaggaggacgtatggttaatggaccacattctaat
tttggtccatctagaccagatcgtgttacatgctctggaccgggacttaaacaagcatat
cttaatgaagctaatacatttacagttaatgcatcacaagcaggtcatgatgtactgtat
gttggagtatctggaccagttgtagcctgtgaagaagtcaatattaaacatatgggttat
ggtcaatattcaattagttatactgtacgtgatcgtggtcgtcatttaattatgattaaa
tggggtgatcaacatgtaccaggcagtccattcactgttgatgttatctaa

DBGET integrated database retrieval system