KEGG   Schistosoma mansoni: Smp_001500Help
Entry
Smp_001500        CDS       T01095                                 

Definition
(RefSeq) putative eukaryotic translation initiation factor 4e
  KO
K03259  
translation initiation factor 4E
Organism
smm  Schistosoma mansoni
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Smp_001500
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Smp_001500
Messenger RNA biogenesis [BR:smm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     Smp_001500
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     Smp_001500
Translation factors [BR:smm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Smp_001500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
2
AA seq 203 aa AA seqDB search
MTAVESEQRVKDEKEKEEEKPRPHPLQDSWSYYLFQFRKALDWDECLEKVATFSTIEDFW
SVLTHTVRPREITYGKDLYMFKSDIMPKWEDPKNENGGRWLINVTARQDVDFLWDELLML
LIGSDWDTDEEDRQICGAVFQPRSRGSKLSVWLTSDNEEETILSIGRRIKERLELEDTIY
FQPVSDQRSQTRGSDICTGKYEI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgagagtgaacaacgcgttaaggacgagaaagaaaaggaagaggagaag
ccgcgtccacatccactccaagactcgtggtcttattatttgttccagttcagaaaggca
ctcgattgggatgaatgtctagaaaaggtggcaactttcagcactattgaggacttctgg
agcgtactcactcatacggttagaccgagagagataacttatggcaaagatttgtatatg
ttcaaatctgatattatgccgaagtgggaggatccgaaaaatgaaaatgggggacgttgg
ctaatcaatgttactgcacgacaagacgtcgactttttatgggatgaattgttgatgctt
ctgatcggttccgactgggatacggatgaagaagatagacagatatgtggagcggtgttc
caaccacggtctcggggtagcaagctttcagtttggctaactagtgacaatgaagaagaa
actatcctaagcattggaaggcgaattaaagagcgtttagaattagaagacacaatctac
tttcaacctgtttctgatcaaagatcacaaactagaggcagcgatatttgtactggaaaa
tatgaaatttag

DBGET integrated database retrieval system