KEGG   Schistosoma mansoni: Smp_001500Help
Entry
Smp_001500        CDS       T01095                                 

Definition
eukaryotic translation initiation factor 4e
Orthology
K03259  
translation initiation factor 4E
Organism
smm  Schistosoma mansoni
Pathway
RNA transport
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Smp_001500
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    Smp_001500
Translation factors [BR:smm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    Smp_001500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 203 aa AA seqDB search
MTAVESEQRVKDEKEKEEEKPRPHPLQDSWSYYLFQFRKALDWDECLEKVATFSTIEDFW
SVLTHTVRPREITYGKDLYMFKSDIMPKWEDPKNENGGRWLINVTARQDVDFLWDELLML
LIGSDWDTDEEDRQICGAVFQPRSRGSKLSVWLTSDNEEETILSIGRRIKERLELEDTIY
FQPVSDQRSQTRGSDICTGKYEI
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgacggctgttgagagtgaacaacgcgttaaggacgagaaagaaaaggaagaggagaag
ccgcgtccacatccactccaagactcgtggtcttattatttgttccagttcagaaaggca
ctcgattgggatgaatgtctagaaaaggtggcaactttcagcactattgaggacttctgg
agcgtactcactcatacggttagaccgagagagataacttatggcaaagatttgtatatg
ttcaaatctgatattatgccgaagtgggaggatccgaaaaatgaaaatgggggacgttgg
ctaatcaatgttactgcacgacaagacgtcgactttttatgggatgaattgttgatgctt
ctgatcggttccgactgggatacggatgaagaagatagacagatatgtggagcggtgttc
caaccacggtctcggggtagcaagctttcagtttggctaactagtgacaatgaagaagaa
actatcctaagcattggaaggcgaattaaagagcgtttagaattagaagacacaatctac
tttcaacctgtttctgatcaaagatcacaaactagaggcagcgatatttgtactggaaaa
tatgaaatttag

  All links  
No link information was found.   
DBGET integrated database retrieval system