KEGG   Schistosoma mansoni: Smp_005210Help
Entry
Smp_005210        CDS       T01095                                 

Gene name
SmHDAC1
Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
smm  Schistosoma mansoni
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:smm00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    Smp_005210 (SmHDAC1)
Enzymes [BR:smm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Smp_005210 (SmHDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 469 aa AA seqDB search
MEVYRPSKAYSEDMTRFHSDEYVKFLKNVRPDNMHEFNKQMQRFNVGEDCPVFDGLFEFC
QLSAGGSIAAAVKLNKQQTDIAINWGGGLHHAKKSEASGFCYINDIVIGILELLKYHQRV
LYVDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLKDIGAGRGKYYAVNCPLRD
GMDDDCYERIFKPVVTKVMETFRPGAVVLQCGADSLCGDRLGCFNLSLKGHGKCVEFIRS
FPLPLLLVGGGGYTIRNVARCWTNETSIALATEIPNDLPYNDYYEYFGPDFKLHISPSNM
ANQNTNEYLEHIKTKLFENLRMIPHCPSVQMQDIPDDIVDFDENDAVAKDLADPDKRISI
MAADKAIMPNNEFFDDPEEGSGLGGTTLRSGKSASRDVQNHRDQPKRARTDEDASSSTTK
PNSKEGSGSKKTDSTGDKRSESKNDFVEKMEVDLSKKANGLIEPERAAN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaagtttataggccatctaaagcatacagcgaagatatgacaagatttcacagtgat
gaatatgtcaaatttttgaagaatgtaaggccagacaatatgcatgaattcaataaacaa
atgcaacgtttcaatgttggcgaagattgtcctgtcttcgatggacttttcgaattttgc
cagttatcggctggtggttctattgctgcagccgtcaaactgaataaacagcaaactgac
atcgccattaactggggtggtggcctccatcatgcaaagaaatctgaggcatcaggattc
tgctacatcaatgacattgtaatagggattttagaacttctgaaatatcaccaaagagtt
ctttatgtggatattgatattcatcatggtgatggtgttgaagaagctttctatactact
gatagagtgatgaccgttagtttccacaagtacggcgagtattttcccggaactggtgat
ctaaaagatattggtgcaggtcgcggtaaatattacgctgtcaattgtccactgagagac
gggatggatgatgattgctacgagcgtatttttaagcctgtcgtgacgaaagttatggaa
acttttcgacccggggccgttgtcttacagtgtggtgctgactcattatgtggtgatcga
cttggatgtttcaatcttagtctgaaaggccatggaaaatgcgtcgaatttatccgctca
tttcctttacctcttcttcttgtaggaggtggtggttatacaatccgaaatgttgctaga
tgctggactaatgaaacatccattgcccttgcaactgagatccccaatgatttaccctac
aatgattattatgagtatttcggccctgacttcaagctgcatataagtccgagcaacatg
gctaatcagaatactaatgaatatcttgagcatataaagacgaaactgtttgaaaatcta
cgaatgatacctcactgtcctagtgttcaaatgcaagatattccggatgacattgttgat
tttgacgaaaatgatgctgttgcaaaagatttagccgaccctgacaaaagaatttcaatt
atggctgctgataaagccatcatgcccaataacgagtttttcgacgatccagaagaaggt
tctgggcttggaggcaccactcttcgatcaggcaaatcagcttcacgagatgttcaaaat
caccgagaccaaccaaaacgcgcacgcacagatgaagatgccagttcatccaccacgaaa
ccaaacagtaaagaaggaagtgggtctaaaaagacagattctactggtgacaagcgttcg
gagtccaaaaacgattttgtagaaaaaatggaagttgatttatccaaaaaagccaacggt
ctaatagaaccggagcgagctgctaattaa

DBGET integrated database retrieval system