KEGG   Schistosoma mansoni: Smp_007640Help
Entry
Smp_007640        CDS       T01095                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
smm  Schistosoma mansoni
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:smm00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 978 aa AA seqDB search
MLESLSACDCHDLGRQVHRYGASRPAGAFFERNSARRLYPSVSHAVFYDQTHDNPSVLEK
HSVFNYLPLSAVGSFACCAIGSTRGYDELVPHYIDVVKEERFYSRWPDQVNYNIGIIKPK
SILNELHSWLSSEGFSETFVDQITPNVLGVTRFCPETREAVLLITHTAFHDPGPNPHHSD
FHPIRLGGRVNRLLCEILSTFKGDYPPQKDFKKNPQYINGLMCMNYSILQNVPATESKTF
HVESYSDEHGVMVDSLLFYNFPPGSVVVVSIKLDESQQQAIADLHNFMSQQVRNNSLLKP
NSIRVLLGNMNLLELNKLLFRCSSEELADGCNFNSYQIPDWGWLVYCGFQSISNVLQGIR
DRNDLGHPICSHLRQGNWLAHYLTERLAKLPSNSNKLITEAIIQMSDILKIMYKPLSNIP
RYLVPAYFEALTVTLTEFIKLETTLRFSPWIRSSSSLVKKLAVATTQFYGFIGNSCLPGR
VIQFNKDSQNPEIEAMFCSLAAGLPHFAEGMWRSWGRDTFISVRGCLLLTGRYQDAANII
LSYASLLRHGLIPNLIGDGYTVKPRYNCRDAVWYWLYSIVIYEQFVSSTKECRLEGDDSS
SILNCPVYRWFPDDDTVGWPDDYLTNSLSSQRIQPLHKTMQEALQRHIIGIEFIERNAGP
TLDEHMKPEGFKVQANIDLNTGFPRGGNAFNCGTWMDKMGSSSKAGNQGIPATPRDGSAV
ELVGLAYAVVSWLAESHNQGPNYAGYYPHAGVQLATGKELSWKEWSNMLKNSFESHFWIP
ESTKDPNLLYNKGIYRDSVGSSGGYTDNQLRPNFLITMVVAPELFTPERAWNALEIAQQR
LTGPFGMCTLSRDDLAYRGYYDNSNDSCDFSIARGFNYHQGPEWLWPTGYYLRARLKFAR
MLGQLDPKKWGHLTLDVTTECQKTFARLNQRMESSQWCSLPELTNANGQLCKDSCEAQAW
SVGCILEALYDLIFTQNK
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaatccctatcagcttgtgactgtcacgatttaggtcgacaagttcatcgatat
ggtgcatctcgacctgctggagcattttttgaacgaaatagtgcacgtcgtctatatccg
agtgtatcacatgctgtcttctatgaccaaactcatgataatccaagtgtattggagaaa
cattctgtttttaattatctacctttatctgcagttggatcgtttgcttgttgtgcaatc
ggtagtacacgtggttatgatgaattagttccacattatattgatgtagttaaagaggaa
cgtttctattcgcgatggcctgatcaagtcaattataatattggtataattaaaccaaaa
tctattttaaatgaactgcatagttggctatcatctgaaggattttctgaaacatttgta
gaccaaattacaccaaatgtgttgggtgtgacacgtttttgtccagaaactcgtgaagct
gtcctattgataacacatacagcttttcatgatcctggacctaatccacaccattcagat
tttcatccaattcggctgggtggacgagtgaatagattgttatgtgaaatactctcgaca
tttaaaggagattatccaccacagaaagatttcaaaaagaatccacagtatataaatggt
ttaatgtgtatgaattactcaattttacaaaatgtaccagccactgaaagtaaaacattt
cacgtagaaagttactcagatgaacatggtgttatggtggatagtttattattttacaat
ttcccaccgggatcagttgtagttgtttcgattaaattagatgagagccaacaacaagcc
attgctgatttacataatttcatgtcacaacaggttagaaataattctttactaaagccg
aattcgatcagagttcttctaggcaatatgaatttattggagctaaacaaattactcttc
agatgttcttctgaagaattagcagatggatgtaactttaattcgtatcaaattcctgat
tggggttggttggtttattgtgggtttcaaagtatttcaaacgtattgcaaggaattcgt
gatcgaaatgatttgggtcatccaatttgttcacatcttcgacaaggtaattggttagcc
cattatttaactgaacgtttggcaaaattaccaagtaattctaataaacttatcactgaa
gcaattattcaaatgagtgatattttaaaaattatgtataaacctctgtcaaatatcccg
agatatttagtccctgcatactttgaagcattgactgttacattaacagaatttattaaa
ctcgagactacattacgattttcaccttggataagaagtagttcatcacttgtgaaaaaa
ttagcagtagcaactactcagttttacggttttattggaaatagttgtctgcctggacgt
gtcatccaatttaataaagattctcaaaatccagaaatcgaagcaatgttttgtagttta
gctgcaggtttgccacattttgcggaaggaatgtggcgttcttggggaagagacacattc
atttctgtccgaggttgccttcttctaacagggcgttaccaagatgctgccaacattatt
ctcagttatgctagtttattaagacatggactaataccaaatcttataggagatggttac
actgttaaaccaagatacaattgtcgtgacgccgtttggtactggttatattctatcgtt
atttacgaacaatttgtttcaagtactaaagaatgccgtctggaaggagatgattcctct
agtattttaaattgtccagtttatagatggtttccagatgatgatacagttggttggccg
gatgattatttgactaattcattatctagtcaacgtatacaacccttgcataaaacaatg
caagaagctttgcaacgacatattattggtattgagtttatcgaaaggaatgccgggcca
actttagatgaacatatgaaaccggaaggatttaaggttcaggccaacattgatttgaat
acaggatttcctcgtggtggcaacgcttttaactgtggtacgtggatggataaaatgggc
agttcatcaaaagctggtaaccagggtatacctgctactcctcgtgatggttcagcagtc
gagttagttggcttggcgtatgcagttgtatcgtggttagcagaatcccacaatcaaggt
ccgaattacgctggctattatcctcatgcaggtgttcaactggcaactggtaaggaactt
tcatggaaagaatggtcaaatatgttgaaaaattccttcgaatcgcacttttggattccg
gaaagcacaaaagaccctaacttattatataataaaggaatttatagggattctgttggt
tcgtctggaggatacacagataatcagctacgccccaatttccttataactatggttgta
gcccctgaattatttacacctgaacgggcatggaatgcactggaaatagctcaacaacga
ttaactggtccatttggtatgtgcactttgagtcgagatgatttagcttatcgaggatat
tatgataactcaaatgatagctgtgacttttctatagctcgtggttttaattatcatcaa
gggccagaatggttgtggccaactggatactatttacgcgctcgtcttaaattcgctcgc
atgttaggccaacttgatcctaaaaaatggggtcatctcactctcgacgtaactacagaa
tgccagaaaacatttgccagactgaatcagagaatggaatcaagtcagtggtgttctctt
ccggaattgacaaatgcgaatggtcagctatgtaaagatagttgtgaagctcaagcgtgg
agtgtcggttgtattttagaagctctgtatgacctcattttcacacagaacaaatga

DBGET integrated database retrieval system