KEGG   Schistosoma mansoni: Smp_008320Help
Entry
Smp_008320        CDS       T01095                                 

Definition
pap-inositol-14-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
smm  Schistosoma mansoni
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:smm00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
AA seq 325 aa AA seqDB search
MRPPLVMKILAASVSLADKACCLIRAVYDSKDLAIIDKGVDDLQSRADRDSQRCIVQSLN
EIFPGLHVIGEEGDLDPGNLPRSTELNLAVLEYQCPPELKDCSLDDIVVWVDPLDGTKEF
TEGLIEFVTVLIGISLAGKPVGGVIAQPFYKANPTANTTDPNYTTRIVWGLVGLGVFGVN
PLLPSSKLPYPINQNAQKLTSPHIIVVTRSHRSLTHDFVDGAFYPTEVLRAGGCGYKVLV
LLEGRAHVYVFPSQGTKKWDTCAPEAVLRASGGILTDLTGQPYKYDLNAKHDNLRGILAT
PVADWLPSYVSCLPKEVLDDFSARD
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccccctcttgttatgaaaatacttgctgcctctgtatctctagcggataaggct
tgttgtttgattcgtgcggtatatgattccaaagacttggccattatagacaaaggagtt
gatgatttgcaatccagagctgatcgagattctcagaggtgcatagtacaatccttgaat
gagatcttcccaggtcttcatgttattggtgaagaaggtgatttggatcctggaaatcta
cctcgatccactgaattaaacttagctgttcttgagtaccaatgtcctccagaactaaaa
gattgttcactggatgatattgtagtttgggtggatccgctggatggtacaaaggaattt
actgaaggccttattgagtttgttacagttcttatcgggatttcgcttgctggaaagcct
gtgggtggtgttatcgctcaacctttttacaaagccaatccaactgcgaatacaactgat
ccgaactatacaactcggatcgtttggggacttgtaggtctgggtgtatttggcgtaaat
cccctgctaccttcttcaaaattgccatatccaatcaaccaaaatgcccaaaaacttact
tcacctcatattattgtggttacccgatcccatcgctctcttactcatgattttgttgac
ggagcattctatcccactgaagttcttcgcgcaggggggtgtggttacaaagttctagtg
cttctggaaggacgtgctcatgtctatgtatttcctagccaaggtactaaaaagtgggat
acatgtgctccggaagctgttcttcgagcatctggtgggatactaacagatttaactgga
caaccttacaaatacgatcttaatgctaaacatgataatcttcgaggcatacttgctact
cctgtcgccgattggttaccatcatatgtttcttgtttgccaaaggaagtgcttgatgat
ttctcagctcgtgattag

DBGET integrated database retrieval system