KEGG   Schistosoma mansoni: Smp_011990Help
Entry
Smp_011990        CDS       T01095                                 

Definition
beta-galactosidase
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
smm  Schistosoma mansoni
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:smm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Smp_011990
  Lipid metabolism
   00600 Sphingolipid metabolism
    Smp_011990
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Smp_011990
   00604 Glycosphingolipid biosynthesis - ganglio series
    Smp_011990
   00511 Other glycan degradation
    Smp_011990
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Smp_011990
Enzymes [BR:smm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Smp_011990
Exosome [BR:smm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Smp_011990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 420 aa AA seqDB search
MKDNISFQYVSGSIHYFRIPEEYWHDRLSKMKAAGLDAIQIYIPWNFHQPEKGVYDFDGD
RNLEKFLELATSLDLLVIARVGPYICAEWDFGGLPVWLLRINPLMKLRSSDPEYMKFVTT
WFNVLLPSMKRFLYENGGPIIMVQLENEYGSYSTCDETYLKELYNLARLHLGENVIIFTS
DGPSNGLLKCGSSDKRYLATVNFGPTTAPVPKVFKVLEDFRQNQPWVNSEYYVGWLDVWG
GDHHKTNPEWAVDGLNRLISYSMRVNVNMYMFQGGTNFGFWNGGARPESSITSYDYDAPI
SEAGDITRKYMIIRDLLFRRKGTEPPKLPRNTTKISYGCVNMKFKSHLLENKAPATRSEF
PLIMESLRQYNGFMIYSVTVTVPRNGSIFLKFFGISDIAHVYTGDKSGHYVSIYFNNCEE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataatatatctttccaatatgtttccggaagtatacattattttcgcattccg
gaggagtactggcacgatcgactttccaaaatgaaggccgctgggttagatgccattcag
atttacataccatggaatttccatcaacccgaaaagggtgtatatgattttgatggtgac
cgaaacttggaaaagtttttggagctggctacatctttagatctgttggtgattgcccga
gtcggaccatacatatgtgctgaatgggattttggtggcctaccagtttggcttttacgg
attaatccattaatgaagttacgctccagtgatccagaatatatgaagtttgtgacgacg
tggttcaatgttttgttaccgagtatgaaacgttttctctatgagaatggtgggccgata
attatggtgcagttagaaaatgaatatggctcctattcaacatgcgacgaaacatactta
aaagagctttacaatttagcacgcctacatttgggggaaaatgtcataatttttacatcg
gatggtccatccaacggtttattaaaatgtggttcgtctgacaaacgctatctagcaaca
gttaactttggtcctacaactgctcctgtacctaaggttttcaaagtattggaggatttc
cgacagaatcaaccctgggtaaatagtgaatattatgttggttggttagacgtgtggggc
ggggatcatcataaaactaatcctgaatgggcggtggatggactgaatcgcctaatcagc
tactcgatgagagtcaacgtaaatatgtatatgtttcagggtggaactaattttggattt
tggaacggtggtgcaagacctgaatcatcaattacgagttatgattatgatgctccaatc
agtgaagctggtgatataacaagaaaatatatgataataagagatctacttttccggaga
aaaggcactgaaccaccgaagttgccaagaaatactacaaagatttcgtatggttgtgtc
aatatgaaatttaaatctcatcttctagaaaataaagctcctgctactcgttctgagttt
cctcttattatggaaagtttgcgacagtataacggttttatgatttattcagtcactgta
acagtcccacgcaatggatctatttttctgaagttctttggtatctcagacatagcgcat
gtttatactggagataaatctgggcattatgtaagcatttactttaataactgtgaagaa
tag

DBGET integrated database retrieval system