KEGG   Schistosoma mansoni: Smp_012980Help
Entry
Smp_012980        CDS       T01095                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
smm  Schistosoma mansoni
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:smm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Smp_012980
Translation factors [BR:smm03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    Smp_012980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
AA seq 225 aa AA seqDB search
MGDWDDEDESDFVAKQVKVDWDDEEDNAVPDSWDAEPPKDSVTSKPAAPAKLSLSERLKL
KEEQKRKEKEEKLRREEELRLSQPVTELQREKLAEEAELGLLKDTFGPSTVQSNDKETID
SCCPKTKEDFNHLHSLLAAKITTIQKSPHFTAFAESLIRDLVIEMEVDALRTVNTVINAL
INEKQKLVKSKTKKKTKGKLLVERENDYQYGVDDDALPDEYDDFM
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactgggacgacgaagatgagagtgattttgttgccaaacaagtgaaggttgat
tgggatgacgaagaggataatgctgtccctgattcttgggatgcagaaccacctaaagat
tcagtgacatctaaaccggctgctcctgctaagttatcgttatctgagcgcctgaaatta
aaagaagaacagaagagaaaggaaaaagaagagaaattgcgaagagaggaagaattaaga
ctttctcaacctgttacagaactgcaacgtgaaaagcttgccgaagaagcagaactcggg
ctgttaaaagatacctttggtccttctactgtccagagtaacgataaagaaacaattgat
tcatgttgtccaaaaactaaagaagatttcaatcacttacactcactactcgcggctaag
atcacaactatacagaaatcccctcatttcacagcgtttgctgagagtttgattcgtgat
cttgtgattgaaatggaagttgacgccctccgaacagtaaatactgtaataaatgcgtta
atcaatgagaaacaaaagcttgtgaagagtaaaacaaaaaagaaaacgaaaggtaaatta
ttagtggaaagagaaaatgattatcagtatggtgttgatgatgacgctctcccagatgag
tatgatgattttatgtga

DBGET integrated database retrieval system